SecReT6
Protein ID: 488655069
SecReT6 ID763
T6SS typei3
Gene symbol-
Locus tagTY21A_13085
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2655689..2657677 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDN0BXL0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-79, Aligned region: 2..289
DUF1215 [PF06744], Evalue: 2.70E-33, Aligned region: 181..202
DUF1215 [PF06744], Evalue: 2.70E-33, Aligned region: 398..519
Protein Sequence: 662 a.a.     [Download]
>gi|488655069|ref|YP_007926872.1| type VI secretion protein IcmF [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MASLYNRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDL
GNSDSVAGFGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAVMESEAPQ
EFTLVRAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVATANDGWVMGRESTPKKLTDS
LRSQIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLG
KAVVEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTD
GGQSGGGTMQIASLLTMLNEYYTQLAIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGT
RKINAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTA
SDPWRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGRKKFSWSMQISVVDMDPAITELVIDIDGQVLR
YAHGPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGKVQETAVRGRQLVEYDFD
GRRVVLEITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 1989 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c2657677-2655689 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
GTGGCGTCGCTGTACAACCGTCTGCTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATG
TGCTGGCAGACGCCATTGCCCGTCAGGACAGTAAAGCTGCGTATGATGCCCTGCGCATCTATCTGCTACT
GAATCTGGATAAAGATCACGAAGATAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTG
GGGAACAGCGACAGCGTGGCCGGGTTTGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTG
ACGGCAGCCGGGTGGTGCATTCACCGTATGAGAAAGATGAGGCGCTGATCCGCCAGGCGCGGGCATTCCT
CGACGGTCACACCAGTACCGAGCGTATCTATGCGCGGGCGCTGGCGGTGATGGAGAGCGAAGCGCCGCAG
GAGTTCACGCTGGTACGCGCCGTCGGCGCGGATGCGGGAACGGTGTTTGTGCGTAGCAACGGCGCGCCGC
TGGATCGGGGCGTGCCGGGTATTTTTACCCGTGAAGGTTACCGGGAGCTGTTCGACAAACGATTACCGGA
ATTTGTGGCGACGGCGAACGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGC
CTGCGCAGCCAGATACCGGGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACGGAAT
ATGCCCGCCGCTGGCAGGATTTTCTGGACAGTATCCATAGTATCAACAGTGCCGGGGAAGAGGGCAGTTC
CGGCCTGGCCTATGATTTACAGGTGCTGCGCACCCTGGCGTCGCCGGACTCACCGCTGATGCGGCTGGGA
AAAGCGGTGGTGGAGCAGACCACGCTGGTGCCGCCGCCGGACCCGCAGGCCAGACAGAAACAACTGGCGC
AGCGCGCGTCCGGTAACGCGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGA
GCGGCTGGAAAAAACGCTGGTGGATGACCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGAC
GGCGGACAGAGCGGCGGTGGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCC
AACTGGCCATTGCTGACAGCGCGCTGGCGGCGGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTT
GCAACTGGAGGCGGCGAAACTGCCTGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACG
CGCAAAATCAACGCCGGGACCGGCGATGTGCTCAACACCCAGATGGAGGCGATGATGGGCGACGACTGCC
GTGACGCCATCGACGGGCGCTATCCGTTCGCCGATAGTCCGCAGGAGGTCAGCGCCGAGGACTTTAACCG
CATCTTCGCCAGCGGCGGCGTACTGGATGCTTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCC
AGCGACCCGTGGCGCTACAAACCGACCGAAGGCAACATGACATTGCAGGGGCCGGATTTAACGCCGTTTC
AGCAGGCGAAGCAGATCCGCAGCGTGTTTTTTAACAGCGAGGGCAGGAAAAAATTTTCCTGGTCGATGCA
GATTAGCGTGGTGGATATGGACCCGGCCATCACGGAACTGGTGATTGATATCGATGGTCAGGTGCTGCGC
TACGCCCATGGTCCGGACCGGCCCCTGAAAGTGACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAA
TCACCGCCAGCCCGCGTATTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCA
TCTGCTGGACGCCGGAAAGGTACAGGAAACGGCGGTGCGGGGGCGCCAATTGGTGGAATATGATTTTGAC
GGTCGCCGGGTGGTGCTGGAAATCACTGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGA
ACTTCAGTTGTCCGGCGAGGGCGTTGTAA
 Primer design