SecReT6
Protein ID: 50085747
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2681
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2635901..2636167 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ6F930
KEGG IDaci:ACIAD2681
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.80E-19, Aligned region: 7..79
Protein Sequence: 88 a.a.     [Download]
>gi|50085747|ref|YP_047257.1| hypothetical protein ACIAD2681 [Acinetobacter sp. ADP1]
MSRPYITIGSPTTGGGKVITANRRFLINGKAIACVGDKATCPTHKTVATIIAGDNHMLVMGKAAAQHNSP
LSCGCKCIADQSLTVGNN
 
Nucleotide Sequence: 267 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2636167-2635901 Acinetobacter sp. ADP1 chromosome, complete genome
ATGTCCCGTCCATATATTACCATTGGATCACCCACTACAGGCGGTGGTAAAGTCATTACTGCCAATCGTC
GTTTTCTGATTAATGGCAAAGCGATTGCATGTGTTGGAGATAAAGCCACGTGTCCAACACACAAGACTGT
CGCAACGATTATTGCTGGCGATAATCATATGCTGGTGATGGGGAAAGCTGCCGCGCAACACAATTCACCT
TTGTCATGTGGATGTAAATGCATTGCTGATCAGTCGTTAACTGTCGGGAATAACTAG
 Primer design