SecReT6
Protein ID: 50085748
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2682
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2636197..2636961 [-]
Productouter membrane lipoprotein
NoteTagL
UniProt IDQ6F929, Q6F929
KEGG IDaci:ACIAD2682
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.90E-26, Aligned region: 109..109
OmpA [PF00691], Evalue: 5.90E-26, Aligned region: 153..247
BON [PF04972], Evalue: 0.00023, Aligned region: 29..65
BON [PF04972], Evalue: 0.00023, Aligned region: 92..111
Pilus_CpaD [PF09476], Evalue: 0.0087, Aligned region: 134..234
Protein Sequence: 254 a.a.     [Download]
>gi|50085748|ref|YP_047258.1| outer membrane lipoprotein [Acinetobacter sp. ADP1]
MKTRHATQLKLCIFVSGWLSLTSVFAQPIIVEGVVPNEASKQAILQKMQAVYGADQVVDKVQVRPVSAPY
GWSDSVTQVISPDLKKVKQGKLTVRGTQVELTGKMSNPNDIQPTISQFQSLVQPPYRFNSQLTINQAEQK
IVDDALKNRIIEFESGSAILTASGQQILDEMAAALKKVGGKKVKIIGHTDSSGDASKNLVLSQERAVAVK
NYLITKNISSDNLSTEGVGSNKPVADNTTAEGRRKNRRIEFEVL
 
Nucleotide Sequence: 765 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2636961-2636197 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAAAACTAGACATGCGACACAATTAAAATTATGCATATTCGTAAGTGGTTGGTTATCACTGACATCTG
TATTTGCTCAGCCGATCATTGTTGAGGGGGTGGTTCCAAATGAAGCATCCAAACAAGCGATTCTACAAAA
AATGCAGGCGGTATATGGTGCAGACCAAGTCGTTGATAAAGTACAGGTGCGTCCTGTATCTGCACCTTAT
GGCTGGAGTGACTCTGTAACGCAAGTGATTAGTCCTGATTTGAAAAAAGTCAAACAAGGCAAACTTACGG
TACGTGGAACACAAGTTGAATTAACTGGAAAAATGAGTAATCCGAATGATATTCAACCGACTATCAGTCA
ATTTCAGTCACTGGTTCAGCCTCCTTATCGCTTTAATTCTCAGCTTACAATCAATCAGGCTGAACAAAAG
ATTGTTGATGATGCACTAAAAAATCGGATTATTGAGTTTGAATCTGGTAGCGCAATTCTCACTGCATCAG
GCCAGCAGATCCTGGATGAAATGGCAGCCGCTTTGAAGAAAGTGGGGGGCAAGAAAGTTAAAATCATTGG
GCATACTGACAGTTCAGGAGATGCCTCGAAAAACTTGGTACTCAGCCAGGAACGTGCAGTGGCTGTAAAA
AATTATCTGATCACTAAAAATATATCTTCAGATAATCTAAGCACGGAAGGTGTAGGTTCAAATAAGCCTG
TTGCAGACAATACAACAGCAGAAGGGCGCCGTAAAAATCGACGAATCGAATTTGAAGTCCTATAA
 Primer design