SecReT6
Protein ID: 50085750
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2684
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2637964..2641785 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ6F927
KEGG IDaci:ACIAD2684
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.60E-73, Aligned region: 188..452
ImcF-related_N [PF14331], Evalue: 7.60E-73, Aligned region: 891..917
IcmF-related [PF06761], Evalue: 9.60E-55, Aligned region: 463..482
IcmF-related [PF06761], Evalue: 9.60E-55, Aligned region: 497..838
IcmF-related [PF06761], Evalue: 9.60E-55, Aligned region: 867..889
DUF1215 [PF06744], Evalue: 9.40E-25, Aligned region: 776..799
DUF1215 [PF06744], Evalue: 9.40E-25, Aligned region: 852..892
DUF1215 [PF06744], Evalue: 9.40E-25, Aligned region: 969..1081
DUF575 [PF04746], Evalue: 0.00088, Aligned region: 31..117
DUF575 [PF04746], Evalue: 0.00088, Aligned region: 455..502
DUF575 [PF04746], Evalue: 0.00088, Aligned region: 862..887
DUF4131 [PF13567], Evalue: 0.0023, Aligned region: 6..81
DUF4131 [PF13567], Evalue: 0.0023, Aligned region: 440..492
Protein Sequence: 1273 a.a.     [Download]
>gi|50085750|ref|YP_047260.1| hypothetical protein ACIAD2684 [Acinetobacter sp. ADP1]
MYTILGYLWQYITNPKAIIALSLLVALISAYSSIPRHIFWILVALYLLGILAYGIYWLIQRRRHAQQGEQ
LAQAIEKDIEVESGLHKNKEELSLIQQQMKESVQLIRKSRLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEESHQKMVSAGLSGTRNCDWFFSTDGVLLDTAGRYSVYSEDHSEWLGFLNLLKKNRPKAPV
NGLIVIVSIAELISQSPESSLKLAKNLRARIQDLTEKLEVIVPVYLVFSKMDLIAGFTEFFECYEAQEYN
QAWGATLPYEQNSSQNAVDLFEQHYTILYEGLKGVSTTHLSRRHAQNISPSVMTFPLEFKTLKPALRSFV
STLFEDNPYQFQPVFRGFYFTSALQEGIVESPMTEQIAQEFHLHPIENSDQQNQHRAHGQNHGYFLKGLF
SDVILKDKELVKQHINPAKKRKRHIAFIGSLVGVSIILGVWVWSYRNNQQLIQDVQADLNKVVQLEKVSG
QQLSTQLDALLILQERLQQLDEFDEHRPLKFSFGLYQGNHLREQLKTEYLKGIRQIVLTPTQQNIAQYLQ
RVKGNEETLKANHSNVEIKQVAKTQQYLEPSDSNPQDAYNALKAYLMMSNPQYRESSHLSDQVTRFWRSW
LDANKGQMPRGEMIQKAEQILSYAMTLSSDTQFPVLQADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMR
AAVRYPAVTVTQIVGESSKGIILGSYALPGMFTHKAWTDYVDQAIEDAANKPTDSKDWVLNSRQSDDLTF
SGSPDQIRKQLTALYKQEYIEEWRKFLNGIHYAKAAQFAQQVKNIDALGEPQNSPIRTLLDRVAIETNWD
NPVVQAELAAPQKGFVAWFKRKVLNRDDQKLKQQAMAKAQGQISQQYQMFYQLVRKRDDQQNKSLLDEYM
ESLAQVRSKFNELKNAGEIGPSAMALVKQTINDQNSVFNTTQKIIDEKMSVGVGELDQQLLQRFLGAPLT
QSFDSLIIPAQDEMNKLWVMQAYQPFTTNLSQKYPFNSSASLQATSAEIGQIFGENGSIARFVKENLDPL
VIRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNQAPAAAPAANQSNFQFYPLQNPQLLS
YSIDIDGQRMTYENGIQQWVNFVWPNQGAIPGARITAVDLQGKTHTIFDEPGEYGINRLIDSAQRKEQNG
SFEMIWKSKADPNLFVKVNFRLISGNHSGNIGSSRGYAGLQLVDKVTTTKAVRVVAAQPAPASSVGQAQN
QPAVTTPPPVGER
 
Nucleotide Sequence: 3822 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2641785-2637964 Acinetobacter sp. ADP1 chromosome, complete genome
ATGTATACAATTTTAGGCTACTTGTGGCAGTACATCACCAATCCTAAAGCAATCATTGCATTGTCGTTGC
TGGTTGCGCTGATTTCAGCATACTCGTCTATTCCTCGACATATTTTCTGGATATTGGTGGCATTATATCT
GTTGGGGATTTTAGCCTATGGTATTTATTGGCTCATTCAGCGACGTCGTCATGCACAGCAAGGTGAGCAA
CTTGCACAAGCCATAGAAAAAGATATTGAAGTAGAAAGTGGACTTCATAAAAATAAAGAAGAGCTCAGTT
TAATCCAGCAGCAAATGAAAGAATCTGTGCAGCTCATCCGTAAATCTCGTCTTGGAGATAAAAAGGGCAA
TGCTGCACTTTACGAATTGCCTTGGTATATGGTGATTGGAAATCCAGCGGCAGGAAAAAGCTCTGCAATC
TACAATTCGGGCTTAAAGTTTCCATTTGAAGAAAGTCATCAAAAAATGGTTTCTGCTGGGTTAAGTGGTA
CGCGTAACTGTGACTGGTTTTTTTCAACAGATGGTGTATTGCTGGATACCGCAGGTCGATATTCTGTTTA
CTCAGAAGATCATTCTGAATGGCTCGGATTCTTGAACTTACTCAAAAAGAATCGACCAAAAGCACCTGTG
AATGGTTTGATTGTTATTGTGAGCATCGCGGAATTGATTAGTCAAAGTCCAGAAAGCTCCTTAAAACTTG
CCAAAAATCTGCGCGCCCGTATTCAGGATCTCACTGAAAAACTGGAAGTGATTGTTCCTGTGTATTTGGT
ATTCTCCAAAATGGACTTGATTGCAGGCTTTACCGAGTTTTTCGAATGCTACGAAGCACAAGAATACAAT
CAGGCATGGGGAGCCACCTTGCCTTATGAGCAAAATTCCTCGCAAAATGCCGTCGATTTATTTGAGCAAC
ATTACACGATTTTGTATGAAGGGCTTAAAGGGGTTAGTACAACGCATTTGAGTCGTCGCCATGCTCAAAA
TATTTCTCCAAGTGTCATGACCTTTCCGCTAGAGTTTAAAACGCTTAAACCAGCATTAAGAAGTTTTGTT
TCAACATTATTTGAAGATAATCCTTATCAGTTCCAGCCTGTATTTAGAGGATTTTATTTCACGAGTGCAT
TACAAGAAGGGATTGTTGAAAGTCCAATGACTGAGCAGATTGCTCAGGAGTTTCATCTACATCCGATTGA
AAATTCTGATCAGCAAAACCAGCATAGGGCACACGGACAAAATCATGGCTATTTTCTCAAAGGACTGTTT
TCTGATGTCATCTTAAAAGATAAGGAGTTGGTGAAACAACATATCAATCCTGCCAAAAAACGCAAGCGTC
ATATTGCCTTTATTGGATCGTTGGTAGGGGTATCCATCATTTTAGGTGTTTGGGTTTGGTCGTATCGTAA
TAACCAACAACTGATTCAAGATGTTCAAGCCGATTTGAATAAAGTGGTACAACTGGAAAAAGTTTCTGGT
CAACAATTATCAACACAGCTTGATGCCTTGCTTATTTTACAAGAGCGCTTACAACAGTTAGATGAATTTG
ATGAACATCGACCACTTAAATTCAGCTTTGGTCTTTATCAGGGCAATCACTTACGTGAACAACTCAAGAC
TGAATATCTTAAGGGTATCCGTCAAATTGTGTTAACACCAACCCAGCAAAATATTGCCCAATACTTGCAA
CGGGTAAAAGGAAATGAAGAAACACTCAAGGCCAATCATTCTAATGTTGAAATTAAGCAAGTTGCCAAGA
CCCAGCAATATCTAGAGCCATCTGATAGTAATCCTCAGGACGCTTATAATGCCCTGAAGGCTTATTTGAT
GATGAGCAATCCGCAATATCGTGAATCGAGTCATTTAAGCGATCAGGTGACACGCTTCTGGCGTTCATGG
CTGGATGCCAATAAAGGACAAATGCCACGTGGTGAAATGATTCAAAAAGCAGAGCAGATTTTATCTTATG
CGATGACTTTATCATCTGATACCCAATTTCCTGTTTTGCAGGCAGATAGCCAACTGGTAGATCAAACCCG
ACAAGTTTTATTGTCGGTGATTCGTGGCATGCCAGCACGAGACCGTGTTTATAATGAAATTAAAATGCGT
GCTGCGGTCAGATATCCAGCCGTAACGGTCACCCAAATTGTTGGAGAGTCGAGTAAAGGAATCATTCTGG
GAAGTTATGCTTTACCAGGCATGTTCACGCACAAGGCATGGACAGATTATGTCGATCAGGCTATTGAAGA
TGCAGCAAATAAACCAACCGATAGCAAGGATTGGGTACTCAATAGCCGTCAGTCAGATGATTTAACCTTT
TCTGGTAGTCCAGATCAGATTCGCAAACAATTAACAGCACTCTATAAACAGGAATATATTGAAGAATGGC
GCAAGTTCTTAAATGGTATTCATTATGCCAAAGCTGCTCAGTTTGCCCAGCAGGTTAAAAATATTGATGC
ATTGGGAGAGCCTCAAAACTCACCAATTCGAACCTTGCTTGATCGTGTCGCAATAGAAACCAACTGGGAC
AACCCTGTTGTTCAAGCAGAACTTGCAGCACCTCAAAAAGGTTTTGTCGCTTGGTTTAAGCGTAAAGTTC
TCAATCGGGATGATCAGAAGCTCAAGCAACAAGCGATGGCCAAAGCTCAGGGACAAATTTCGCAACAGTA
TCAAATGTTTTATCAGTTGGTACGCAAGCGTGATGACCAGCAAAACAAGTCCTTGCTGGATGAATATATG
GAAAGTCTGGCACAAGTACGAAGTAAATTTAATGAATTGAAAAATGCAGGTGAAATTGGTCCGAGCGCAA
TGGCACTGGTGAAACAGACTATTAATGATCAGAATTCGGTGTTTAATACAACACAGAAAATTATTGATGA
AAAAATGTCTGTGGGAGTAGGTGAGTTGGATCAGCAATTATTGCAGCGTTTTCTTGGCGCTCCGCTGACT
CAGTCATTTGATAGCCTTATCATTCCTGCTCAAGATGAAATGAATAAGCTGTGGGTGATGCAGGCTTATC
AACCATTTACGACCAATTTAAGCCAAAAGTATCCATTTAATTCTTCTGCGAGTTTGCAAGCGACCAGCGC
CGAAATTGGACAAATTTTTGGTGAGAATGGCAGTATTGCCCGATTTGTAAAAGAAAATCTTGATCCTTTG
GTGATTCGTCGTGGTTATACCTTAACCTCTAAAACATGGAAAGATCTGGGAATTAGTTTAAATCCACAAT
TTGTAATGAACTTTCAGCGTTATGTCGCACCAACCAATGGTATGGCAACGGGAGAGTTAAATCAGGCACC
AGCAGCTGCACCTGCGGCCAATCAATCCAATTTCCAGTTTTATCCATTACAAAATCCGCAGTTACTTTCA
TATTCCATCGATATTGATGGACAGCGTATGACCTATGAAAACGGCATTCAGCAATGGGTAAATTTTGTCT
GGCCAAATCAGGGTGCAATTCCTGGTGCACGAATCACGGCAGTAGATTTACAAGGCAAAACACATACGAT
ATTTGATGAGCCAGGTGAATACGGAATTAACCGTTTGATTGATAGTGCTCAACGTAAAGAACAAAATGGC
AGCTTTGAGATGATCTGGAAAAGCAAGGCGGATCCGAATCTATTTGTCAAAGTCAATTTCCGTCTGATTA
GTGGTAACCATTCAGGCAATATTGGATCAAGTCGTGGTTATGCAGGTTTACAACTGGTGGATAAGGTCAC
TACCACTAAAGCCGTACGTGTGGTTGCTGCACAACCAGCACCAGCATCATCTGTGGGTCAGGCGCAGAAT
CAGCCAGCAGTGACAACACCGCCACCTGTGGGAGAGCGCTAA
 Primer design