SecReT6
Protein ID: 50085752
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2686
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2643220..2644218 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ6F925
KEGG IDaci:ACIAD2686
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.30E-66, Aligned region: 19..311
Protein Sequence: 332 a.a.     [Download]
>gi|50085752|ref|YP_047262.1| hypothetical protein ACIAD2686 [Acinetobacter sp. ADP1]
MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPKTEIEHLAQSD
ERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLTVQYVDASLVHHLPVRYEVEQ
ENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNNTAHALTTMLTCIFKQKVMVKEFIREKFYLS
DEQKTCLGGAQPSLLGINTFCGDTIEQIDGKIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLL
VDLRLILDQDDVQPFCLDSVHQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA
 
Nucleotide Sequence: 999 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2644218-2643220 Acinetobacter sp. ADP1 chromosome, complete genome
ATGCGTACAGAACGTTGGTGGCAAGACACTTCTGTAACCGATCATTTGTTTCGGCAATTTGGCAGATTTG
AGTTTATTCAGGCAACACGATTATTACGTCATGTACCTTATCACATGGATCAAACTCAGTGGGCCAGTGA
GTTCCAATTTGGTTCCTCTTTAGCACTTAGTTTTCCCAAGACTGAAATCGAGCATCTTGCTCAAAGCGAT
GAGCGGATTGAGATGACTAGTCTAGTAGTCGGTTTAACTGGAACACAAGGGGCTTTGCCTTATACCTATA
CCAATAAACTCAAGCAAAGTTCACGTCAGCAACGCCGTGAGATTCAGGCATTTTTAGGTCTGTTTAATCA
CACTTTAACTGTACAGTATGTCGATGCTAGTTTGGTTCATCATCTACCTGTACGTTATGAGGTAGAGCAA
GAAAATCATTATTTAAATATTTTACATGCCTTGAATGGATATATTTCATCACATCATCAGCACAACGAAT
TAGATGAGTATTTTGCTGAATTTGCAGGACTAATGCAGGGACAAAATAATACTGCACATGCCTTAACTAC
AATGTTGACATGTATTTTTAAGCAAAAAGTGATGGTTAAAGAGTTTATTCGAGAAAAATTTTATTTAAGT
GACGAACAAAAAACCTGTTTGGGAGGGGCACAACCCAGTTTGCTTGGTATCAATACTTTTTGTGGCGATA
CAATTGAACAGATTGATGGAAAAATTGAAATTCAGATTGGCCCTTTAAAACGTAAACAATACTTAGACTT
TTTACCGAGTGGGCGCGCGAGTACACAGCTTAAGCATATTTTAGCAACATGGTGTAGTCCCACTTTACTG
GTCGATCTACGCTTAATTCTGGATCAGGATGATGTACAACCTTTTTGTCTGGATTCAGTCCATCAAATGG
GATTGGGACAGGGTGTTTTTCTGACTTCTCAGGCTTCCAATCAGGATAATCAAGATACGTGTTATTCGCT
GATAGGAGCCGTAGCATGA
 Primer design