SecReT6
Protein ID: 50085753
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2687
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2644182..2645990 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ6F924
KEGG IDaci:ACIAD2687
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.60E-157, Aligned region: 5..602
Protein Sequence: 602 a.a.     [Download]
>gi|50085753|ref|YP_047263.1| hypothetical protein ACIAD2687 [Acinetobacter sp. ADP1]
MIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARIDKKIADSYDF
FTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRSFKGVQCEFNTAYEVRLLPIS
LVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEKLPIYLDAISNFPLQLLDQIFKKETRFSLRV
GHQSFDINNPFEMMGFSEAEALLPLDQHTHHAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLI
HLKLNLNDPASVRNYSELDVENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDM
QMIREKTHQEQAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ
LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLNTLALMKGESL
SHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVKAEISIDTSVFRGHSVYIFSQ
LVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKTLL
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2645990-2644182 Acinetobacter sp. ADP1 chromosome, complete genome
GTGATCGAAGAACTTTTGCCTTATTATGAAAAACAGCTTCAAGAGTTTAGTCAGCAATCACGTGAATTTG
CGCTGAAATATCCTAAAATTGCACAGCGTTTGGCTTTAAATCAGGAACAAATTGACGATCCACATATTGA
GCGTCTAATTCAGGCCTTTTCATTAATTGCAGCCCGAATCGATAAAAAAATTGCTGATAGTTATGATTTT
TTTACACGTTCTCTATTTGAGGTGATGTTTCCACAGTATTTAAGACATTTTCCTGCGTGTAGTGTGGTCA
GTTTTGAAGATTTGCAAAAATTAAAACAATTGACAGAGCCACATATTATTCCAAAGCAAACGAAACTTAA
ATCAAGAAGCTTTAAAGGCGTTCAATGTGAGTTTAATACGGCTTATGAGGTTCGATTATTGCCGATTAGT
CTGGTCAAACTTGAATTTAAGACCTTACAACATACGCATGCACATCTCACACAAAATGCGAGCCTGAATT
TTCATTTTAGCTTACTCAATCCTTTACAATCTTGGTTATATCAAGAAAAATTACCTATCTATTTAGATGC
GATCTCTAATTTTCCTTTACAACTTCTTGATCAAATTTTTAAAAAAGAAACTCGTTTTTCTCTGCGTGTA
GGGCATCAATCTTTTGATATTAATAATCCATTTGAAATGATGGGTTTTTCAGAAGCTGAGGCATTACTCC
CACTTGACCAGCATACCCATCATGCTTATCGCTTATTGATGGAGTATTTTTGTTTCCCTGAAAAATTCAA
TTATTTGAATTTGAATTTATCACAGCTTAAGGCATTCATCACTACCCAAACTGAGTTTGAGCTTTTAATT
CATCTAAAACTTAATCTGAATGATCCTGCAAGTGTGCGTAATTATTCAGAACTTGATGTCGAAAATTTTA
AGCTTTTTACTACACCAGTGATTAATTTATTTGAAAAGCAGGCCGAACCGCAAAAAATCAATCATCAACA
GCTTGAATATCCGTTAATCACAGATGCACATTATCCTGATGCTTATCAGGTGTATTCCATCATTGATATG
CAAATGATTCGTGAAAAAACACATCAAGAGCAAGCGATTGTTCCTGTTTTACCCTTTTTTGCAATGAGTC
ACTATCATGATCATCAGGTTAAGTTTTTCTATGCATTACATCAGCAGAAGCTGACTAAACATCATGTAGA
AACTCGTTTTTCCATTGTATCTAAACAGCTTGAACCCTATAACACCACTTCTGATTTTGTAAGTACTCAA
TTACTTTGTTCTAATCGGGATTTACCGTATGAAGTGCTTGGGCAGACTCACACTTCGCTCAATTTAAATG
ACAGTAATCTTGCGCGCCGCGCTGTAGTGTTAAAGAGACCAACACTGCCTTATCAGTTTGAGCAACATAA
AAATGAGCAGTGGAGAATTATCTCCCATCTTTCATTAAATACTTTGGCACTGATGAAAGGGGAAAGTTTG
TCTCATTTAAAAGAGCTGTTGGCTTTATATAATTTGCCACGTTCTAAAGAGAATCATTTATTGATTGATG
CGATCAAACAATTGAATTTTAGTCTGACGCACAAGCTAGTTGAAGCCAAACCGTTTCCAATGTTTGTTCG
TGGGGTCAAGGCCGAGATAAGTATCGATACATCAGTCTTTAGAGGTCATAGTGTTTATATTTTTAGTCAA
TTAGTGAGTCACATTTTAAATCTTAAAGTTCAAATGAACAGTTTTGTAGATGTGGTGATTCGGGATAGTG
TTCGTCAACAGGAGTTATACCAATGCGTACAGAACGTTGGTGGCAAGACACTTCTGTAA
 Primer design