SecReT6
Protein ID: 50085754
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2688
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2646002..2646475 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ6F923
KEGG IDaci:ACIAD2688
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-19, Aligned region: 31..134
Protein Sequence: 157 a.a.     [Download]
>gi|50085754|ref|YP_047264.1| hypothetical protein ACIAD2688 [Acinetobacter sp. ADP1]
MNLDHLYPFGFRSTLFDRLTPEYEDLKGLSIHQLRESVARDLEDLLNSRVAKMDDVLVNYPLARQSILQF
GIIDFVGLSTANPMDREKICQSIEQSIAAHEPRLKQVKVEMLLDGHNMGALCLSIQAYLNIHPLYEPVVF
DALLKPTTQQYVISAQT
 
Nucleotide Sequence: 474 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2646475-2646002 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAATCTCGATCATTTGTATCCTTTTGGATTTAGGTCAACATTGTTTGATCGACTCACGCCTGAATATG
AAGATCTAAAAGGTTTATCTATTCATCAGTTGCGTGAATCCGTCGCACGGGATCTGGAAGATCTCTTAAA
TAGTCGTGTGGCTAAAATGGATGATGTACTGGTTAATTATCCTCTGGCGCGTCAGTCTATTTTGCAATTT
GGGATCATTGATTTTGTAGGATTATCGACAGCCAATCCGATGGATCGAGAAAAAATTTGTCAGTCTATCG
AGCAATCGATTGCTGCACATGAGCCTCGATTAAAACAGGTAAAAGTTGAAATGCTACTGGATGGACACAA
TATGGGGGCGCTGTGTTTGAGTATTCAGGCCTATCTTAATATTCATCCACTCTATGAACCTGTTGTTTTT
GATGCGTTGTTAAAGCCGACAACACAACAATATGTCATTTCTGCCCAGACTTAA
 Primer design