SecReT6
Protein ID: 50085755
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2689
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2646545..2647048 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ6F922
KEGG IDaci:ACIAD2689
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|50085755|ref|YP_047265.1| hypothetical protein ACIAD2689 [Acinetobacter sp. ADP1]
MKDIYVQFRGKYKVDGESRDSEHKDWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMLFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEVFGLKYAAVEWTYN
QQDINGSAKGAVTKKWSLSNNTASYAA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2647048-2646545 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAAAGATATATACGTTCAATTTCGAGGTAAATATAAGGTTGATGGTGAGTCACGTGATTCTGAGCACA
AAGACTGGCTTGAAGTCAACTCGTGGTCGCATAATATTCGCCAGCCAAAATCTGCAACTTCAAGTAGCGT
AGGTGGTCACACTGCTGAACGTGTTGAGCATTCAGATATGCTTTTTGTTAAAGATTTGGATGCAACCAGC
CCTAAACTGTGGGAAGCATGCTCTGCAGGTTATACCTTTGATGAAGTACAGATCGATTTTTATCGTGCCA
ATGGTGATAAACGTATCAAGTACCTTCAAATCAAACTCAAACATGTTTTAGTTTCAAGTGTAACTCCGAC
TGTAAATGAAGAGGGTGTACCTACTGAAGTGTTTGGTTTGAAATATGCTGCAGTTGAGTGGACTTATAAC
CAGCAAGACATTAACGGTTCTGCTAAAGGTGCTGTGACTAAAAAATGGTCTCTTTCAAATAACACTGCAT
CTTACGCTGCGTAA
 Primer design