SecReT6
Protein ID: 50085756
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2690
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2647094..2648590 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ6F921
KEGG IDaci:ACIAD2690
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.40E-193, Aligned region: 70..494
Protein Sequence: 498 a.a.     [Download]
>gi|50085756|ref|YP_047266.1| hypothetical protein ACIAD2690 [Acinetobacter sp. ADP1]
MRRLIMNNPQLANNTALEPENTTLLDSIVEQSRIARNDEEHVRAKNLIGELAKEVMAGTITVSENMTLSI
DKRIAEIDALISAQLSQIMHHEKFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFD
QSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAADPSMFGLESYTD
IDRPRDVSKIFETAEYVQWRSFRDSEDARYVALTMPRVLGRLPYHPKEGTATEGFNFIEDVTGQDHNEYL
WMNAAYAFGTRLTNAFDLHGWCAAIRGVEGGGLVEGLPVHTFKTHDGEVAFKCPTEIAITDRREKELSDL
GFIPLVHCKNTDYAAFFGAQSTQKPKKYDSDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASA
GNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLV
TELPQSSN
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2648590-2647094 Acinetobacter sp. ADP1 chromosome, complete genome
GTGCGGAGGTTGATCATGAATAATCCTCAACTCGCAAATAATACTGCACTTGAACCTGAAAATACGACGT
TGCTTGATTCGATTGTTGAGCAGAGTCGAATTGCCCGAAATGATGAAGAGCATGTTCGGGCTAAGAACCT
GATCGGCGAGTTGGCAAAAGAGGTGATGGCTGGAACAATTACTGTTTCGGAAAATATGACTTTGTCGATT
GATAAGCGTATTGCTGAAATTGATGCTCTTATCTCAGCACAGTTAAGTCAGATCATGCACCATGAAAAGT
TTCAGAAAATTGAATCGACATGGCGCGGCTTATATTATTTTTGTCAGGAAACACCTTCAAATCCGCTGAT
TAAAATTCGGATGCTGAACACCACCAAGAAAGAACTGGTCAAAGATTTTCAGGGTGCAACAGATTTCGAT
CAGAGCACTTTGTTTAAAAAAATTTATGAAGAAGAATATGGTTCCTTTGGTGGAGCCCCTTATTCTGCAC
TGATTGGTGATTTTGAATTTGATCGTACCCCATCAGATATGTATTTGCTTGAGCAAATCTCACATGTTGC
TGCTGCTGCTCATGCGCCGTTTATTTCGGCGGCAGATCCAAGCATGTTTGGTCTGGAAAGTTATACCGAT
ATCGACCGTCCGCGTGACGTCTCCAAAATTTTTGAAACAGCCGAATATGTGCAGTGGCGATCTTTCCGTG
ACAGTGAAGATGCACGTTATGTCGCATTGACCATGCCGCGCGTGCTGGGTCGTTTGCCATATCATCCTAA
AGAAGGAACCGCAACAGAAGGTTTCAATTTTATAGAGGATGTGACTGGTCAGGATCACAATGAATATCTA
TGGATGAATGCTGCTTATGCATTTGGTACACGTTTAACCAATGCCTTTGATTTGCATGGATGGTGTGCTG
CGATTCGCGGTGTCGAAGGTGGTGGTTTAGTTGAAGGCTTACCTGTACATACCTTTAAGACTCACGATGG
TGAGGTGGCGTTCAAATGTCCAACAGAAATTGCAATTACTGACCGACGTGAAAAAGAACTGAGTGATTTG
GGTTTCATTCCACTCGTTCATTGTAAAAATACCGATTATGCCGCTTTCTTCGGTGCGCAATCGACACAGA
AGCCAAAAAAATATGACAGTGATACTGCCAATGCCAATTCGGCATTGTCTAGCCAGATTCAATATATTAT
GGCGGTATCCAGAATTGCACATTATTTAAAAGCAATGATGCGCGATAAAGTCGGAAGTTTCGCTTCAGCA
GGGAATGTCGAAGCATTCTTGAATGAATGGTTGTCTCAATATGTATTGCTTGATGATGGTGCTTCACAGG
AAGCCAAAGCCCAGTATCCACTTCGTGAGGCATCCGTAAAGGTTGTAGAAGACCCAGCACAGCCTGGTCA
CTACAAATCTGTGGTCTTCTTAAGACCGCATTTCCAGCTGGATGAGTTGTCAGTTTCTTTAAGACTGGTG
ACGGAACTTCCGCAGTCCTCTAACTAG
 Primer design