SecReT6
Protein ID: 50085757
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2691
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2648568..2649077 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ6F920
KEGG IDaci:ACIAD2691
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-58, Aligned region: 13..168
Protein Sequence: 169 a.a.     [Download]
>gi|50085757|ref|YP_047267.1| hypothetical protein ACIAD2691 [Acinetobacter sp. ADP1]
MTMAKRESVQKKLQRIRPPRVQLTYDVEIGDGKEAKELPFVVGVMGDFSAASELEKTKLKDKKFINVDLD
NIDDVMQSMAPRAAFDVENTLTEEGGRMNVDLTFNSMQDFSPEQITQQVEPLRKLVEARERLTDLRNKIS
NNERLEDLLDEVLKNTDQVRKLSAEVDHE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2649077-2648568 Acinetobacter sp. ADP1 chromosome, complete genome
TTGACCATGGCGAAAAGAGAAAGCGTTCAAAAAAAGCTTCAGCGCATTCGACCACCACGTGTTCAGCTCA
CCTATGATGTTGAAATTGGTGATGGTAAAGAGGCGAAGGAATTACCATTTGTCGTGGGTGTAATGGGGGA
TTTTTCGGCTGCATCCGAGCTTGAAAAAACCAAACTTAAAGATAAAAAATTTATTAATGTTGATTTGGAT
AATATCGACGATGTTATGCAGTCTATGGCTCCACGAGCCGCTTTTGATGTCGAAAATACACTGACAGAGG
AAGGCGGACGCATGAACGTGGATTTAACCTTTAATTCAATGCAGGATTTTAGTCCTGAACAAATTACACA
GCAGGTAGAGCCATTACGTAAATTGGTAGAAGCCCGTGAAAGACTGACAGACTTGCGCAATAAAATTTCT
AATAACGAGCGTCTAGAAGACTTGCTGGATGAGGTTCTAAAAAATACGGATCAAGTACGTAAACTCAGTG
CGGAGGTTGATCATGAATAA
 Primer design