SecReT6
Protein ID: 50085759
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2694
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2650125..2652809 [+]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDQ6F918
KEGG IDaci:ACIAD2694
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 230..247
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 605..773
AAA [PF00004], Evalue: 5.40E-22, Aligned region: 229..342
AAA [PF00004], Evalue: 5.40E-22, Aligned region: 475..525
AAA [PF00004], Evalue: 5.40E-22, Aligned region: 610..696
AAA_16 [PF13191], Evalue: 7.20E-15, Aligned region: 206..250
AAA_16 [PF13191], Evalue: 7.20E-15, Aligned region: 273..308
AAA_16 [PF13191], Evalue: 7.20E-15, Aligned region: 517..590
AAA_16 [PF13191], Evalue: 7.20E-15, Aligned region: 582..653
AAA_16 [PF13191], Evalue: 7.20E-15, Aligned region: 673..703
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 229..249
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 303..359
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 609..727
ClpB_D2-small [PF10431], Evalue: 2.90E-12, Aligned region: 383..396
ClpB_D2-small [PF10431], Evalue: 2.90E-12, Aligned region: 779..851
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 64..84
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 228..322
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 358..389
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 506..569
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 606..642
AAA_25 [PF13481], Evalue: 6.00E-08, Aligned region: 229..301
AAA_25 [PF13481], Evalue: 6.00E-08, Aligned region: 423..486
AAA_25 [PF13481], Evalue: 6.00E-08, Aligned region: 605..636
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 226..245
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 605..708
AAA_19 [PF13245], Evalue: 2.90E-07, Aligned region: 229..250
AAA_19 [PF13245], Evalue: 2.90E-07, Aligned region: 605..631
AAA_14 [PF13173], Evalue: 3.30E-07, Aligned region: 229..332
AAA_14 [PF13173], Evalue: 3.30E-07, Aligned region: 559..575
AAA_14 [PF13173], Evalue: 3.30E-07, Aligned region: 607..691
AAA_18 [PF13238], Evalue: 1.10E-06, Aligned region: 64..138
AAA_18 [PF13238], Evalue: 1.10E-06, Aligned region: 229..249
AAA_18 [PF13238], Evalue: 1.10E-06, Aligned region: 471..547
AAA_18 [PF13238], Evalue: 1.10E-06, Aligned region: 610..639
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 229..260
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 491..491
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 608..646
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 799..884
IstB_IS21 [PF01695], Evalue: 5.70E-06, Aligned region: 223..250
IstB_IS21 [PF01695], Evalue: 5.70E-06, Aligned region: 608..629
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 229..326
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 609..635
Arch_ATPase [PF01637], Evalue: 1.90E-05, Aligned region: 61..101
Arch_ATPase [PF01637], Evalue: 1.90E-05, Aligned region: 208..242
Arch_ATPase [PF01637], Evalue: 1.90E-05, Aligned region: 281..376
Arch_ATPase [PF01637], Evalue: 1.90E-05, Aligned region: 477..490
Arch_ATPase [PF01637], Evalue: 1.90E-05, Aligned region: 605..654
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 229..249
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 485..496
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 604..659
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 228..247
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 299..309
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 569..630
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 678..703
T2SE [PF00437], Evalue: 0.00047, Aligned region: 200..248
T2SE [PF00437], Evalue: 0.00047, Aligned region: 582..650
AAA_29 [PF13555], Evalue: 0.00074, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 0.00074, Aligned region: 604..622
Torsin [PF06309], Evalue: 0.001, Aligned region: 565..632
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 230..252
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 610..631
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 37..78
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 105..128
TIP49 [PF06068], Evalue: 0.0015, Aligned region: 229..268
TIP49 [PF06068], Evalue: 0.0015, Aligned region: 277..309
TIP49 [PF06068], Evalue: 0.0015, Aligned region: 609..644
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 230..301
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 608..630
ResIII [PF04851], Evalue: 0.0029, Aligned region: 210..250
ResIII [PF04851], Evalue: 0.0029, Aligned region: 287..311
ResIII [PF04851], Evalue: 0.0029, Aligned region: 467..478
ResIII [PF04851], Evalue: 0.0029, Aligned region: 581..631
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 229..249
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 281..305
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 609..630
DUF258 [PF03193], Evalue: 0.0054, Aligned region: 225..249
DUF258 [PF03193], Evalue: 0.0054, Aligned region: 582..629
DUF815 [PF05673], Evalue: 0.0067, Aligned region: 223..272
DUF815 [PF05673], Evalue: 0.0067, Aligned region: 605..647
AAA_28 [PF13521], Evalue: 0.0072, Aligned region: 229..262
AAA_28 [PF13521], Evalue: 0.0072, Aligned region: 609..632
Protein Sequence: 894 a.a.     [Download]
>gi|50085759|ref|YP_047269.1| ClpA/B-type chaperone [Acinetobacter sp. ADP1]
MRFMMSNLKILITKLSGNSRTALEKSANSCILLQNFEIEIEHLFLELLNQNSSNDIQILLKKYKINTEEL
IEDLNRALSSLPKGNNRTPIFSKSIVRLLEQAWLLASADQNPIIRSGHLLIALLTAPDLYQIAVRASDLF
DVLPIDLMKHKFIEDCIKSVENAQLQQDENPVSQQASIETKNKTPALDQFTINLTEKAKSGSIDPVIGRE
YEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPPALRNVQLHSLDIGLLQAGASVKGE
FENRLKQVIQEVQSSTHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYFE
KDAALSRRFQVVKVEEPTETVAIDMLRAMIPVMQQHFKLQIDDEAIITAVHASHRYISGRQLPDKAISVL
DTAAARVALTQNAQPVKLDQLQAKLHNLKLEQNILDTEHRHSSMHEERLTKLAKEISQLEENIDEVYKRW
QQERELVQKIQNIEINTDAPETADDQQINELRSELYQLQGHEPLVFERVNAQMINEIISDWTGIPIGNMV
NDEIQHILQLEQKLAQRVMGQDYALQQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALAEEL
YGGEQHLITINMSEYQEAHTVSSLKGTPPGYVGYGQGGVLTEAVRRHPYSVVLLDEIEKAHSDVQELFYQ
VFDKGMLEDGEGRLIDFKNTTILLTSNAGSSAIMKVCLSQPVEEWPDAIELIEHLKPSLYKQFKPAFLGR
MRIVPYFPLHDDLLVKIIHHKLGKVTARLEKQYGTRVQYSEPLVETILQRCTEVDSGARNVDHILNSTIL
PELATQILVALAEQKLPKHIMIDVKNDDIVYQLDPVEKKIAKKRSAKTIKETEA
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|50083297|ref|NC_005966.1|:2650125-2652809 Acinetobacter sp. ADP1 chromosome, complete genome
TTGAGATTTATGATGAGCAATTTAAAAATTCTAATTACCAAATTATCGGGTAACTCTCGGACAGCATTAG
AAAAATCTGCAAATTCATGTATTTTGTTACAAAACTTTGAAATAGAAATAGAACATCTGTTTTTGGAATT
ACTAAATCAGAATAGTTCAAATGATATACAGATTTTACTAAAAAAATACAAAATTAATACTGAGGAGTTG
ATAGAGGATTTAAACAGGGCTCTATCTAGCCTGCCTAAAGGCAATAATCGTACCCCTATTTTTTCTAAAT
CGATTGTAAGATTATTGGAACAAGCATGGTTACTTGCCTCTGCAGATCAAAACCCAATTATCCGAAGTGG
ACATTTACTAATTGCTTTATTAACAGCACCAGATCTTTATCAGATTGCCGTACGCGCATCTGATTTATTC
GATGTTTTACCTATTGATTTAATGAAACATAAGTTTATTGAAGATTGTATAAAAAGCGTAGAAAATGCTC
AGTTACAACAAGATGAAAATCCAGTATCTCAACAGGCTTCAATAGAAACTAAAAATAAAACACCTGCCTT
GGATCAATTCACTATTAATCTTACTGAAAAAGCAAAAAGTGGTTCGATTGATCCTGTTATTGGACGCGAA
TACGAGATTCGACTGATGCTCGATATTCTAATGCGTAGAAGACAAAATAACCCTATTCTGACAGGTGAGC
CAGGGGTTGGAAAAACGGCTGTCGTTGAAGGTTTAGCTCTGAAAATTGCTCAGGGTCTTGTACCTCCAGC
TTTAAGAAATGTGCAGCTTCACAGTTTAGATATTGGTTTATTACAAGCAGGAGCCAGTGTCAAAGGTGAA
TTTGAAAACCGTCTAAAACAAGTTATTCAAGAAGTACAATCTTCTACTCATCCTATTATTTTGTTTATTG
ATGAAGCTCATACGTTAATTGGTGCAGGTGGTCAAGCAGGTCAGAATGATGCAGCTAATTTATTAAAACC
AGCGCTGGCACGCGGTGAGCTGCGCACTATTGCGGCAACAACATGGGCCGAATATAAACAATATTTTGAA
AAAGATGCCGCGCTGAGTCGTCGTTTTCAAGTCGTCAAGGTTGAAGAGCCAACCGAAACTGTTGCAATTG
ATATGCTACGGGCCATGATTCCGGTAATGCAGCAACATTTTAAACTACAAATAGACGATGAGGCCATCAT
TACAGCAGTACATGCTTCTCATCGCTATATCAGTGGGCGACAGCTTCCAGACAAGGCCATTAGTGTACTC
GATACAGCAGCAGCCAGAGTCGCATTGACCCAAAATGCGCAACCCGTGAAGCTGGATCAGTTACAAGCCA
AGCTACACAATCTAAAACTCGAACAAAACATTCTAGACACTGAACATCGCCATTCTTCTATGCATGAAGA
ACGCCTGACCAAACTTGCCAAAGAAATTAGCCAGCTTGAAGAAAATATCGATGAAGTCTATAAACGCTGG
CAACAAGAACGAGAGCTCGTTCAAAAAATTCAAAATATTGAAATAAATACAGATGCTCCTGAGACAGCAG
ATGATCAACAAATAAATGAATTAAGATCCGAGCTTTATCAATTACAGGGTCATGAACCGCTAGTCTTTGA
GCGAGTTAATGCTCAGATGATTAATGAAATTATTTCTGACTGGACAGGTATTCCTATTGGAAATATGGTG
AATGATGAAATCCAGCATATCTTACAACTTGAACAAAAACTTGCTCAGCGCGTAATGGGACAAGATTATG
CGTTACAGCAACTGGTTCAAGGTATCAAAACATCTAAAGCCAAACTTGAAGATCCCAATAAACCTCAAGG
TGTATTTTTACTGGTTGGCCCAAGTGGCGTGGGTAAAACAGAAACAGCTTTAGCCTTGGCTGAAGAGCTT
TATGGTGGAGAGCAGCATCTAATCACTATCAATATGTCTGAATACCAAGAGGCCCATACCGTATCTTCTC
TTAAAGGTACGCCTCCTGGCTATGTTGGATATGGTCAGGGCGGTGTTTTAACAGAAGCAGTAAGACGTCA
CCCGTACAGTGTGGTTTTACTTGATGAAATTGAAAAAGCACATAGCGATGTTCAGGAACTTTTTTATCAG
GTTTTTGATAAAGGTATGCTCGAAGATGGTGAAGGACGTTTAATCGATTTTAAAAATACGACGATTCTCC
TCACTTCAAATGCGGGTTCAAGCGCGATCATGAAAGTCTGCCTGAGTCAGCCTGTAGAGGAATGGCCAGA
TGCCATTGAGTTAATTGAACATCTAAAACCAAGTCTCTACAAACAATTTAAACCCGCATTTTTGGGGCGC
ATGCGTATTGTGCCTTACTTCCCACTACATGACGATTTACTGGTTAAAATTATTCACCATAAACTGGGTA
AAGTAACTGCGCGTCTTGAAAAACAATACGGCACACGAGTGCAATATTCAGAGCCACTGGTTGAGACAAT
TTTACAACGCTGCACCGAAGTAGATAGTGGCGCACGCAATGTAGATCACATCTTAAACTCAACCATATTA
CCTGAACTGGCTACTCAGATTTTGGTGGCACTTGCAGAACAGAAGTTACCAAAGCACATCATGATTGATG
TCAAAAATGATGACATCGTTTATCAACTTGATCCCGTTGAAAAAAAGATAGCCAAGAAACGTAGTGCTAA
AACCATCAAAGAAACCGAAGCTTAA
 Primer design