SecReT6
Protein ID: 50085760
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2695
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2652825..2653928 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ6F917
KEGG IDaci:ACIAD2695
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-20, Aligned region: 55..115
Protein Sequence: 367 a.a.     [Download]
>gi|50085760|ref|YP_047270.1| hypothetical protein ACIAD2695 [Acinetobacter sp. ADP1]
MSINISELLQPITEQSPCGEDYSFSNEFHLIKKARTQDDVLLDQGDWVTELKQADWETVTSTSSNLLKTK
TKDIRLLTWLSEGWANLYGFEGIYQGIELSHRLLDQFWNDIHPVVEDDDLDQRIALLQGLINQLPLLIKK
TPLINTSPYYHLLNYENFLHHQNIRRKQSDEYEQLDGPSEIELFEQALFNTSKSFQYQNYQMFKHVVSQW
QQLKDVLDRLMGVDAPSFAAIDSSLQDIDVNLRKIYKAEAFDTNPVATSSATASSHASETLSTEPMPTSN
VNVNQPSFQPQTQNHIQNREQAIRVLQDISDYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHP
LQLVQEALGVQPKNEYE
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|50083297|ref|NC_005966.1|:2652825-2653928 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAGTATAAACATTTCAGAGTTGTTACAGCCAATTACTGAACAATCTCCATGTGGAGAGGATTACTCAT
TTTCCAATGAATTTCATCTGATCAAAAAAGCCAGAACACAAGATGATGTCTTACTTGATCAGGGCGATTG
GGTCACTGAATTGAAACAGGCTGATTGGGAAACAGTGACCAGTACCTCATCAAACCTATTAAAAACAAAA
ACCAAGGATATTCGCTTACTTACTTGGCTGAGTGAAGGATGGGCTAATCTATATGGATTTGAAGGTATTT
ATCAGGGCATTGAATTAAGTCATCGTTTACTGGATCAATTCTGGAATGACATCCATCCTGTGGTAGAAGA
TGATGATCTGGATCAAAGAATCGCATTGTTACAGGGCTTAATTAATCAACTGCCCTTACTCATCAAGAAA
ACACCTTTAATTAATACGTCGCCTTATTATCATTTGCTCAATTACGAAAATTTTTTACATCATCAGAATA
TTCGACGTAAGCAAAGCGACGAGTATGAACAGTTAGATGGTCCCTCTGAAATCGAACTATTTGAACAAGC
TTTATTTAATACATCAAAAAGTTTTCAATATCAGAATTATCAAATGTTTAAGCATGTTGTATCTCAATGG
CAACAGCTTAAGGATGTACTGGATCGCCTGATGGGAGTGGATGCTCCAAGTTTCGCAGCAATTGATTCCA
GCCTGCAAGATATTGATGTCAATCTCCGTAAAATTTATAAAGCCGAAGCCTTCGATACAAATCCAGTAGC
AACTTCATCGGCTACAGCTTCTAGCCATGCTTCTGAAACATTGAGTACCGAGCCTATGCCTACCTCAAAT
GTCAATGTAAACCAGCCGAGCTTTCAACCGCAAACCCAAAATCACATTCAAAATCGTGAACAAGCGATTC
GGGTATTGCAAGATATTTCTGACTACTTTCAGGCAAATGAGCCTCATAGTCCCGTCAGTTATATGCTGCA
AAAAACGATTAAATGGAGCCAGATGCCATTACATGAATGGTTAGCACAAGTCATTAAAGATGAGCATCCG
TTACAGTTGGTACAAGAAGCTCTTGGTGTACAACCTAAAAATGAATATGAATAA
 Primer design