SecReT6
Protein ID: 50085761
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2696
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2653945..2655312 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ6F916
KEGG IDaci:ACIAD2696
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-127, Aligned region: 19..452
Protein Sequence: 455 a.a.     [Download]
>gi|50085761|ref|YP_047271.1| hypothetical protein ACIAD2696 [Acinetobacter sp. ADP1]
MFKAEKILWGEGLFLRPQHFQIQDSYHEQRLNQTIRATIPFAYGINQLRFDELQLGNHVLALESIEMIWQ
DGEIYQAPSTDLLPEPLLLDDLNFKGEMLIYLTLPLLQPNKTNILHDGDDHRSGRYHSHLTETHDLYTNA
QAADITLLRRRAMFRLLAPLSEPQQEFDGLLYLPLGRIKRQSSGSFELDQKFIPPILHIEASDTLTSNLK
RTLNVIRAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHATLNHLLQHPQIHPERLFFELLRLT
GSLLTFSTAYEVDHLPQYRHHQLQDSFQQLDVILRDLLDTIISSRYISIALKEIRPSYWIGSLESDKITR
DSRLYIAVSSSMMQTHELVQIVPLRFKVGSTVDVEQRVVAALPAIPLHHLMQVPTAIPVRSGVSYFEIEP
HHELYQRMLESESICIYIPSGFQDISIELIAVMNA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|50083297|ref|NC_005966.1|:2653945-2655312 Acinetobacter sp. ADP1 chromosome, complete genome
ATGTTTAAAGCAGAAAAAATCCTATGGGGCGAAGGCTTATTTTTACGTCCGCAACATTTCCAGATTCAGG
ATAGTTACCATGAGCAACGTTTAAACCAGACCATTCGTGCGACCATTCCGTTCGCCTATGGGATTAATCA
ATTGCGTTTCGACGAGCTGCAACTGGGCAATCATGTACTGGCATTAGAAAGCATCGAAATGATCTGGCAA
GACGGCGAAATTTACCAAGCCCCAAGCACCGACTTATTACCAGAACCTTTGCTACTCGATGACCTCAATT
TTAAGGGAGAGATGTTGATCTATCTCACCCTGCCGTTATTACAACCCAATAAGACAAATATCTTGCATGA
TGGTGATGATCATCGATCTGGCCGTTATCACTCACATCTAACCGAAACACACGATTTGTATACCAATGCT
CAGGCTGCAGACATTACGCTGTTACGGCGTCGTGCAATGTTTAGATTGCTTGCACCTCTGTCCGAGCCAC
AACAAGAATTTGATGGTTTGTTATATTTACCTTTAGGTCGGATCAAGCGCCAAAGTTCTGGTTCATTTGA
GCTGGATCAAAAATTTATTCCACCAATTTTACATATTGAAGCATCAGATACACTGACCTCAAATCTTAAA
CGGACTCTGAATGTCATTCGAGCAAAAATTAAGACCATTCAAACCAATAATCGAGAAAACGAACAGAAAC
TGATTGAATTCCGTTCTGGTGATATCGTTTCTTTTTGGCTGGTCAATGCTTTAAACACAGCTCACGCCAC
ACTCAACCATCTGCTTCAACACCCGCAAATACATCCCGAACGACTTTTCTTTGAATTACTCCGTTTGACA
GGTTCTTTGCTAACATTTTCTACAGCATATGAAGTAGATCATCTTCCTCAATACCGACATCACCAACTAC
AAGATAGTTTTCAGCAACTTGATGTGATTTTGCGTGATCTGTTAGACACCATTATTTCTAGTCGCTATAT
CAGTATTGCGCTTAAAGAGATTCGTCCATCTTATTGGATCGGAAGCTTGGAATCAGACAAAATTACGCGA
GATAGCAGACTTTATATTGCGGTTTCAAGTAGCATGATGCAGACCCACGAACTGGTTCAAATTGTTCCTT
TACGTTTTAAAGTGGGGAGTACGGTGGATGTTGAACAACGTGTTGTCGCAGCTTTACCTGCAATTCCATT
ACACCACCTGATGCAGGTACCTACCGCGATTCCTGTACGCTCAGGTGTGAGTTATTTTGAAATTGAACCC
CATCATGAACTTTATCAACGTATGCTAGAGTCAGAATCGATATGTATTTATATCCCTTCAGGTTTCCAAG
ACATTAGCATTGAATTAATTGCTGTAATGAATGCCTAA
 Primer design