SecReT6
Protein ID: 50085762
SecReT6 ID61
T6SS typei4b
Gene symbol-
Locus tagACIAD2697
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2655324..2656127 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ6F915
KEGG IDaci:ACIAD2697
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-54, Aligned region: 33..238
Protein Sequence: 267 a.a.     [Download]
>gi|50085762|ref|YP_047272.1| hypothetical protein ACIAD2697 [Acinetobacter sp. ADP1]
MSQPTGIPSLFDDGKIGGDFSPPNTQNVSQAVNLVDLLHDGFYIVFLIRNQYVPANIEEFRQKILDLLNR
FEQQAKKMQFSGDDIYDAKYAFCALLDETIVTQQDPNFFHLQNAWLISPLQLSLFGSQLAGYRFFEILEQ
LRSKGKERLTSLEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKAAFSPFSAIPDQIRHMI
HGELPFFWILIILLIFALLTFGGLRYMLSHQTDRALAPYQNVVSAPAEEAHITIYLP
 
Nucleotide Sequence: 804 bp     [Download]
>gi|50083297|ref|NC_005966.1|:2655324-2656127 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAGTCAACCTACAGGCATCCCTTCTCTGTTCGATGATGGCAAAATAGGTGGAGATTTTTCTCCCCCAA
ATACTCAAAATGTCAGCCAGGCTGTCAATCTGGTCGATTTATTACATGATGGTTTTTATATTGTTTTTCT
GATTCGCAATCAATACGTACCTGCCAATATTGAAGAGTTCCGTCAAAAAATCCTTGATTTGCTTAATCGT
TTTGAACAGCAAGCAAAGAAAATGCAATTTTCAGGCGATGATATCTATGATGCGAAATATGCGTTTTGTG
CTTTGCTTGATGAAACAATTGTGACTCAACAAGACCCAAACTTTTTTCATTTACAAAATGCTTGGCTCAT
TAGTCCCTTGCAACTTAGCCTGTTTGGTTCTCAGCTTGCAGGTTATCGCTTTTTTGAAATACTGGAGCAA
TTAAGAAGTAAAGGCAAAGAGCGTCTGACTTCACTCGAAGTCTTTCATTATTGTTTACTTCTAGGATTTC
AGGGTAAATACCGCATTGAATCAATTGAAAGTCTTAACCATTTGGTCGCGCGCGTTGGAGATGAAATTGA
TTATCTGAAAGGAAAAAAGGCTGCGTTTTCGCCTTTTTCCGCCATCCCTGATCAGATTAGACACATGATC
CATGGTGAATTGCCGTTTTTCTGGATTCTGATTATTCTGCTGATTTTTGCCTTACTTACTTTCGGTGGAC
TAAGATATATGTTGTCTCACCAAACAGATCGTGCGCTTGCGCCTTATCAAAATGTCGTTTCTGCACCTGC
CGAAGAAGCACATATTACGATTTATTTACCATAA
 Primer design