SecReT6
Protein ID: 50122355
SecReT6 ID40
T6SS typei1
Gene symbol-
Locus tagECA3432
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3845233..3848730 [-]
Productvirulence-associated protein
NoteTssM
UniProt IDQ6D1L4
KEGG IDeca:ECA3432
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.00E-91, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 2.10E-70, Aligned region: 202..457
DUF1215 [PF06744], Evalue: 3.90E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|50122355|ref|YP_051522.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MFKTIITFLRKQLPKLKPSWLLLGALLWVVVLVLAWWLGPRLTVGESRPLQGIWGRVVFTLVWLWLAFSY
SAWLVWRRVQQMRAERHEHQVIEQDPLQVYVDGQQTFLDRWLEAFQTQLGKKALYAMPWYLTIGLAGSGK
SSLIHRANPANKMNPKLDAALRDVAAGQLVSSWVGESAVIWDPSGQLLAQPELAGDSLGLRHARLWQHLL
QWLSENRRRQPLNGLVLTLDISWLAQAGVADRKAYAQVMRARLQEISVNINTRLPVYIALTRLDMLSGFD
KVYRQLNRDARQAILGVTFTPQASNSKGWLEELERFWDEWVTHLNDNLPDMLLTQSDRSVRNSLFSFVRQ
LAGVKDYVMEVLTETLATGEDRAFLIRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINAALRGESNTFF
VQRLFPDVIFPEASLAGENRLHSLYRRRRLSIGVGCMLLASLALVGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQPGYGYQQLPRLNLIRDATLSFGNYHERTPLLADLGLYQGGKIGPYVEGTYLQMLNQRFLPAV
MQGLLEDLNQAPANSEQKLTILRVMRMLDDASGRNKVLVEQFMAQRWQKAFPAQGNVQEQLMQHLDYALE
HTDWHKAREQKYAAAISTFTPFNQPITLAQQELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDP
VFSLRNDKAGSVPRLLTYPGFSDYYLKQDKALLELTALDAWVLGQRERAQFSEADRREILRQVNDRYITD
YINQWQKVLANIDVQTLDTPEQALDILTDITGNDQPFQRVLTTVSDNTRIRKLSDDDNDTAQGINTRTGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYPFDPSSNKDVPLSEMEMFFMT
GGTLDSFYQTNLKAMMESGMLEEGMASPLQAELVKQLERATRIRQTLFNAQGSLEVHFVLEPLELTANKR
RSVLNLDGQLLEYSHGRRQKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFSGPWAMFRLVNSDQLTQ
VNENTFDVRFSLENGAMTYRVYTDASHNPFAGGLFSQFTLPDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3848730-3845233 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTTTAAAACAATCATAACCTTTCTACGCAAGCAGTTGCCTAAACTGAAACCCTCCTGGCTGCTTTTGG
GAGCGCTACTGTGGGTCGTAGTGTTGGTTCTAGCCTGGTGGCTTGGGCCGCGTTTGACGGTGGGCGAGTC
ACGCCCGTTGCAGGGAATCTGGGGCCGCGTGGTGTTCACGCTGGTCTGGCTGTGGTTGGCGTTCTCCTAC
AGCGCCTGGCTGGTCTGGCGTCGCGTACAGCAGATGCGCGCAGAGCGCCATGAACATCAGGTGATTGAGC
AGGATCCCTTACAGGTGTATGTCGACGGTCAGCAGACGTTTCTCGATCGCTGGCTGGAGGCATTTCAGAC
CCAGTTGGGTAAAAAAGCGTTGTATGCGATGCCCTGGTATTTGACGATTGGTCTGGCCGGTAGTGGCAAA
AGCAGCCTGATCCATCGCGCCAATCCGGCAAACAAAATGAATCCGAAGTTGGATGCCGCGCTGCGAGACG
TAGCGGCAGGCCAGCTGGTGAGTAGCTGGGTCGGGGAATCCGCTGTCATCTGGGATCCTAGTGGACAATT
ACTGGCGCAGCCTGAGCTGGCGGGTGATTCGCTCGGGCTGCGCCATGCCCGACTGTGGCAGCACCTGCTA
CAATGGCTCAGTGAAAATCGTCGCCGCCAGCCGCTCAATGGTCTGGTTCTCACGCTGGATATTTCCTGGT
TGGCACAGGCCGGTGTCGCGGATCGTAAAGCCTATGCGCAAGTCATGCGCGCGCGTTTGCAGGAAATTTC
TGTCAACATCAATACGCGCTTACCGGTGTATATCGCGCTGACTCGACTGGATATGCTGAGCGGCTTCGAT
AAGGTCTATCGCCAGTTAAACCGCGATGCGCGTCAGGCCATTTTAGGCGTGACGTTTACTCCGCAGGCGA
GCAACAGCAAAGGTTGGCTGGAAGAACTAGAGCGTTTCTGGGACGAGTGGGTCACGCACCTGAATGACAA
CCTGCCAGACATGCTGCTGACGCAATCGGACAGAAGTGTGCGCAATTCGCTGTTCTCGTTCGTCCGCCAG
TTGGCTGGAGTGAAAGATTACGTGATGGAAGTGCTGACGGAAACGTTAGCGACGGGCGAGGATCGCGCGT
TCCTGATCCGTGGCGTCTACGTCAGTTCTGTCTATCAACAGGGGGTGCCGTTCGATGCTTTTGCGCAGTC
GGCTTCCCGACGCTATCAACTGCCAGAGCCGATTAACGCTGCGCTGCGCGGTGAGTCGAACACGTTCTTT
GTGCAACGTCTTTTCCCTGATGTCATTTTTCCGGAGGCCAGTCTGGCGGGGGAAAACCGACTGCATAGTC
TCTATCGTCGTCGTCGGCTCAGTATCGGCGTGGGCTGTATGCTGCTCGCCAGTCTGGCGCTAGTCGGCAG
TTGGCACCATTTCTATCGGGTCAATGAAGAAGCCGGACGTAATGTACTGACGAAAGCGCAGGCGTTTATC
GGCACCAATGAGCTGGAAGGGCAGCCGGGCTATGGCTATCAGCAGTTGCCGCGTCTGAATTTGATTCGTG
ATGCGACCTTATCCTTTGGTAATTACCACGAACGTACGCCGCTGCTAGCCGATCTTGGCCTGTATCAGGG
CGGTAAGATTGGGCCTTATGTTGAAGGCACTTATCTGCAAATGCTGAACCAGCGCTTTCTCCCTGCGGTG
ATGCAGGGGCTGTTGGAAGATTTGAATCAGGCACCCGCTAATAGCGAGCAAAAGCTGACGATTCTGCGTG
TGATGCGGATGTTGGATGATGCGTCAGGACGCAATAAAGTGCTGGTCGAACAGTTTATGGCGCAGCGCTG
GCAGAAGGCGTTTCCCGCACAGGGCAATGTGCAGGAACAACTGATGCAGCATCTGGATTACGCCCTTGAG
CATACCGACTGGCATAAGGCCCGTGAGCAAAAATATGCGGCGGCGATCAGTACCTTTACGCCATTTAATC
AGCCGATTACGTTGGCTCAACAGGAGCTGAGCAAGCTGCCGATGTATCAGCGCGTTTATCAGAGTTTGGT
GATGAAAGCGACGCAGGTGCTGCCGCCGGATTTAGCGATCCGTGATGAAGTCGGCCCGACGTTTGATCCG
GTGTTTTCCTTGCGTAATGACAAAGCGGGAAGTGTGCCGCGGCTGCTGACGTATCCCGGTTTCAGTGATT
ATTACCTCAAGCAGGACAAAGCGCTGTTAGAACTGACGGCATTGGACGCCTGGGTTCTGGGCCAGCGTGA
GCGTGCGCAGTTTAGCGAGGCAGACCGTCGGGAAATTCTGCGTCAGGTGAACGATCGCTACATTACGGAT
TACATCAACCAGTGGCAGAAAGTGTTGGCGAACATTGATGTGCAGACGCTCGATACGCCGGAGCAGGCGC
TCGATATTCTCACGGATATTACCGGCAACGATCAGCCCTTCCAGCGAGTGTTGACCACGGTCAGTGATAA
CACCCGAATCCGTAAGCTGTCCGACGATGATAACGACACGGCGCAAGGTATCAACACGCGCACTGGTCGT
CCGTTTATGACTATCAATGCGGCACTGAGCGGACGTGGTGAGCAGGGGCCATTGGTGCAAGAGGTTAATC
AGAAGCTGACCGACCTCTATCACTACCTCGATCAGATCGTCAACGCGACCGATCCAGGGCAGGCAGCGTT
GAAAGCGGTGCAGGCGCGGCAGGGAAATAAATTTGCCGATCCAGTCTTCGCCTTACAGCAATACGCCCGT
AGCCTTCCCGCGCCACTGGATCGCTGGGTAGGACAATTAGCCGGAGAAAGCGCCAGTCTGGTGACTGGGC
TTGCGATGTCGTCGCTGAATCAAGAGTGGCTGGATAAAGTTGTGACGCCATTCAATGAGAAGCTGGCGGA
TCGTTACCCCTTCGACCCGTCATCGAACAAGGATGTGCCGCTATCGGAAATGGAAATGTTCTTCATGACT
GGCGGGACGCTGGACAGCTTCTATCAAACCAACCTCAAGGCGATGATGGAAAGCGGCATGCTGGAAGAAG
GGATGGCGTCGCCTTTACAGGCTGAGCTGGTGAAACAGCTGGAGCGTGCTACCCGCATCCGCCAGACCCT
GTTTAATGCGCAGGGTAGTCTGGAAGTGCACTTTGTTCTGGAGCCGCTGGAACTGACGGCGAACAAGCGC
CGCAGCGTACTCAATCTGGACGGACAACTGCTGGAATACAGTCACGGTCGTCGTCAGAAAACGCCGCTGG
TGTGGCCAAACAGTATGCGAGATGGGGCTGAGAGCAAGCTAACTCTGGTGCCGGACGATCGTGAGCGCTC
ACCACGTAGCCTGAGCTTTAGCGGGCCGTGGGCGATGTTCCGGTTAGTCAACAGCGACCAGCTAACGCAG
GTTAATGAGAACACCTTCGACGTGCGCTTCTCGCTGGAAAACGGCGCGATGACGTATCGCGTATATACCG
ATGCCAGCCATAACCCGTTTGCTGGTGGTCTGTTCAGCCAATTCACGCTGCCTGACTCGCTTTATTAA
 Primer design