SecReT6
Protein ID: 501683443
SecReT6 ID764
T6SS typei3
Gene symbolprkC
Locus tagPFLCHA0_c60370
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6693510..6696593 [-]
Productserine/threonine-protein kinase PrkC
NotePpkA
UniProt IDR4REP2
KEGG IDpprc:PFLCHA0_c60370
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.00E-49, Aligned region: 9..249
Pkinase_Tyr [PF07714], Evalue: 1.90E-33, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 2.10E-11, Aligned region: 250..266
VWA_2 [PF13519], Evalue: 2.10E-11, Aligned region: 610..791
VWA_2 [PF13519], Evalue: 2.10E-11, Aligned region: 866..919
APH [PF01636], Evalue: 7.30E-06, Aligned region: 14..121
APH [PF01636], Evalue: 7.30E-06, Aligned region: 120..150
APH [PF01636], Evalue: 7.30E-06, Aligned region: 239..282
Kinase-like [PF14531], Evalue: 0.0012, Aligned region: 119..210
VWA [PF00092], Evalue: 0.0029, Aligned region: 610..733
Protein Sequence: 1027 a.a.     [Download]
>gi|501683443|ref|YP_008003269.1| serine/threonine-protein kinase PrkC [Pseudomonas protegens CHA0]
MDILIPGFDIQGEIGEGAMASVYLATQRSLERKVALKVMAAALAADPSFCERFLREGKTLARLSHPHTVT
IHDIGNVGELYYMAMEYLPNGTLKERIAAGLTPEQGLTYIRQIASALGYAHAQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARGQDIDGRADLYALGVVLYEILVGELPYNGTD
ALSTALAHLTEPLPELPLHHGRYQHILRKLLAKDPAERYPDAAALLAALDNLPAATAEVEATLIQPLPLP
PQAASQPVPQGNDLAGLTPVSIEIPQQAPRPAPRREPPEEPPAPPRTANLPPAGSGPSEQRRGPVLALAG
VAVAVALAVAGAGYWWLSGDSPAPEPKTASTAGTTPAVVAPPASQPVAADVDGGQRPLLMPGKKTLFQRV
LSKPGASFSSEPGAAPGQAVPAFSVLYVYQRKNLDGRSWLRLGAASDGRSAGWLPAEQVSDWKQSLVLKF
TERSGRAPVMFVRQASELERLLADPAAAKNLLLKAQKNPQDEQQVLALEPNASAVPQDQFYLLPIFDSKE
SFDDNGQPVQLLNVASIDPGNSPQSISDSSGKRLPANTPPAAGDAFRTAVVLVVDTSVSMQPYIDQVRDV
VHELQSKIAQRGELDSVSFGLVGFRNNTSKTPGLEYVTKTLVTLDQGRDPQRFQELVSQVKATSVSSHSF
NEDAFAGVMQAVEGMDWKGYGGRLILLVSDAGALRKNDPYSRTQMNEAEVRQAALGKQIKIYALHLRTDA
GKKNHAQAETQYRVLTADANPKIGDLYIPVPGGDVGKFGERVDEIGTVFADLVHQVRSNQSQEVPVLAAA
PSITQKSAAIGYAMHMDFLGRKSASQAPQLVSAWTADRDLTNPALPAFQVCVMLTKLQLNDLQQSLKLIV
DAARKTQTSPKDFFQEIASASAYMSRDPSALRKGGNLADGGVLGEYLEGLPYRSKSLNMTQDLWLSLSVA
EQEDFIDELDSKIRLYETFHNDLANWVRFGDAEPGDALYRVPLSTLP
 
Nucleotide Sequence: 3084 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6696593-6693510 Pseudomonas protegens CHA0, complete genome
ATGGACATTCTGATTCCCGGCTTTGACATCCAGGGCGAAATTGGCGAAGGCGCCATGGCCAGCGTGTACC
TGGCGACCCAGCGTTCCCTGGAACGCAAGGTGGCACTCAAGGTGATGGCCGCGGCGCTGGCCGCCGACCC
GAGCTTCTGCGAGCGCTTCCTGCGCGAGGGCAAGACCCTGGCGCGGCTGTCGCACCCGCACACCGTGACC
ATCCACGACATCGGCAATGTCGGCGAGCTGTACTACATGGCCATGGAGTACCTGCCCAACGGCACGCTGA
AAGAGCGCATCGCCGCCGGGCTGACCCCGGAGCAGGGCCTGACCTATATCCGCCAGATCGCCTCGGCCCT
GGGCTATGCCCATGCCCAGGGGCTGGTACACCGCGATGTGAAGCCGGCCAACATCCTGTTCCGCGCCGAC
GGCACCGCGGTGCTCTCGGACTTCGGCATCGCCAAGTCCCTGGACGACCGCACCCAGTTCACCCAGGCCG
GTTTTGCCGTAGGCACCCCGAGCTACATGAGCCCCGAACAGGCTCGTGGCCAGGACATCGACGGCCGCGC
CGACCTCTATGCCCTGGGGGTGGTGCTGTATGAAATCCTGGTGGGCGAGCTGCCTTACAACGGCACCGAC
GCGCTGTCCACAGCCCTGGCCCACCTGACCGAGCCGCTGCCGGAGCTGCCGCTGCACCACGGTCGCTACC
AGCACATCCTGCGCAAGCTGCTGGCCAAGGACCCGGCCGAGCGCTACCCGGATGCCGCCGCCTTGCTGGC
GGCCCTGGACAACCTGCCGGCCGCCACCGCCGAGGTGGAAGCGACGCTGATCCAGCCCTTGCCGCTGCCA
CCCCAGGCTGCGTCGCAGCCTGTACCTCAGGGCAACGACCTGGCCGGGCTGACCCCGGTGTCCATCGAGA
TCCCGCAGCAGGCGCCCCGACCGGCGCCGCGCCGCGAGCCGCCCGAGGAGCCGCCCGCGCCGCCGCGCAC
GGCCAATCTGCCGCCAGCCGGCAGCGGGCCTTCCGAACAGCGGCGCGGCCCAGTGCTGGCCCTGGCTGGG
GTCGCCGTGGCGGTGGCCCTGGCAGTGGCGGGCGCCGGTTATTGGTGGCTGTCGGGCGACAGCCCGGCGC
CAGAACCCAAGACCGCCTCGACAGCCGGCACCACGCCTGCGGTGGTGGCGCCCCCGGCCAGTCAGCCGGT
GGCCGCGGATGTCGACGGCGGCCAGCGACCGCTGCTGATGCCGGGCAAGAAAACCTTGTTCCAGCGGGTG
CTGAGCAAGCCAGGGGCGAGTTTCTCCAGCGAGCCTGGGGCTGCGCCGGGCCAGGCGGTGCCGGCGTTCT
CGGTGCTCTACGTGTATCAGCGCAAGAACCTCGACGGCCGCTCCTGGCTGCGCCTGGGGGCCGCCAGTGA
CGGTCGCAGCGCCGGCTGGTTGCCGGCCGAACAGGTCAGCGACTGGAAGCAGAGCCTGGTGCTGAAATTC
ACCGAGCGTTCCGGTCGTGCACCGGTGATGTTCGTGCGTCAGGCCAGCGAGCTGGAGCGTTTGTTGGCGG
ACCCTGCGGCGGCCAAGAACCTGCTGCTCAAGGCACAGAAGAACCCCCAGGACGAACAGCAGGTGCTGGC
CCTGGAACCCAACGCCAGCGCGGTGCCACAGGACCAGTTCTACCTGCTGCCGATCTTCGATTCCAAGGAG
AGTTTCGACGACAACGGCCAGCCGGTGCAGTTGCTCAATGTGGCTTCCATCGACCCGGGCAACAGCCCGC
AGAGCATCAGTGACAGTAGCGGCAAGCGCCTGCCGGCCAATACTCCTCCGGCGGCCGGCGATGCCTTCCG
CACTGCGGTGGTGCTGGTGGTGGACACCTCGGTGTCGATGCAGCCCTACATCGACCAGGTGCGCGATGTG
GTGCACGAGCTGCAAAGCAAGATCGCCCAGCGCGGCGAGCTGGACAGCGTCAGCTTCGGCCTGGTGGGCT
TTCGCAACAACACCAGCAAGACCCCGGGCCTGGAGTACGTGACCAAGACCCTGGTGACCCTGGACCAGGG
TCGCGATCCCCAGCGCTTCCAGGAGCTGGTGAGCCAGGTCAAGGCCACCAGTGTCTCCAGCCATTCGTTC
AACGAAGACGCCTTTGCCGGCGTGATGCAGGCCGTGGAGGGCATGGACTGGAAGGGCTATGGCGGCCGCC
TGATCCTGCTGGTCAGCGATGCCGGGGCGCTGCGCAAGAACGACCCTTACAGCCGCACCCAGATGAACGA
GGCGGAAGTGCGCCAGGCAGCCCTGGGCAAGCAGATCAAGATCTACGCCCTGCACCTGCGTACCGATGCC
GGCAAGAAGAACCACGCCCAGGCGGAAACCCAGTACCGGGTGCTGACCGCCGACGCCAACCCGAAGATCG
GCGACCTGTACATTCCGGTGCCCGGTGGCGATGTGGGCAAGTTCGGCGAGCGGGTCGACGAGATCGGCAC
GGTGTTCGCCGACCTGGTGCATCAGGTGCGCAGCAACCAGAGCCAGGAAGTCCCGGTGCTGGCGGCGGCG
CCGAGCATCACGCAGAAGTCGGCGGCCATCGGCTACGCCATGCACATGGATTTCCTCGGCCGCAAGTCCG
CCAGCCAGGCGCCCCAGCTAGTCAGCGCCTGGACCGCCGACCGCGACCTGACCAACCCGGCGCTGCCGGC
GTTCCAGGTCTGTGTGATGCTCACCAAGCTGCAACTCAACGACTTGCAGCAGTCGCTGAAACTGATCGTC
GACGCGGCGCGCAAGACCCAGACCTCGCCCAAGGATTTCTTCCAGGAAATCGCCAGCGCCAGTGCCTACA
TGAGCCGCGACCCGTCGGCCCTGCGCAAGGGCGGCAACCTGGCCGACGGCGGCGTGCTGGGGGAATACCT
GGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGACCCAGGACCTGTGGCTGTCCCTGAGCGTGGCC
GAGCAGGAAGACTTCATCGACGAGCTGGATTCGAAGATCCGCCTCTACGAAACCTTCCATAACGATCTGG
CCAACTGGGTGCGCTTCGGTGATGCCGAGCCGGGTGATGCCCTGTACCGCGTTCCGTTGTCGACCCTGCC
GTGA
 Primer design