SecReT6
Protein ID: 501683444
SecReT6 ID764
T6SS typei3
Gene symbolprpC2
Locus tagPFLCHA0_c60380
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6696596..6697330 [-]
Productprotein phosphatase PrpC
NotePppA
UniProt IDR4RHA3
KEGG IDpprc:PFLCHA0_c60380
PDB IDNA
Domain hit(s) vs Pfam PP2C [PF00481], Evalue: 3.20E-13, Aligned region: 33..234
PP2C_2 [PF13672], Evalue: 8.30E-13, Aligned region: 22..202
SpoIIE [PF07228], Evalue: 1.20E-06, Aligned region: 38..240
Protein Sequence: 244 a.a.     [Download]
>gi|501683444|ref|YP_008003270.1| protein phosphatase PrpC [Pseudomonas protegens CHA0]
MRSAPQLSYQSASYSHVGMVRKINEDAWLEAPETGLWLVADGMGGHAAGDYVSSLIVDSLRAVPAADSLD
DYVAALRNGLAAVNAAVREETANRGVTMMGSTVVLLAVRGARAVCLWAGDSRLYRLRDEQLEGISRDHSY
VQDLQDSGLLSEAEARVHPRANIVTRAIGVEAQLELSQIDLQVQDGDTFLLCSDGLNKTAEDFELRDVLS
HSEPNDVVRSLIHLGLTRGAPDNITAIVIKAAGH
 
Nucleotide Sequence: 735 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6697330-6696596 Pseudomonas protegens CHA0, complete genome
ATGCGTTCAGCGCCGCAACTGTCCTACCAGTCCGCCAGCTACAGCCATGTCGGCATGGTGCGGAAAATCA
ATGAAGACGCCTGGCTCGAAGCCCCGGAGACCGGCCTGTGGCTGGTGGCCGACGGTATGGGCGGGCACGC
CGCCGGGGACTATGTCAGCAGCCTGATCGTCGACAGCCTGCGGGCGGTTCCGGCCGCCGACAGCCTGGAC
GACTATGTCGCCGCGCTGCGCAACGGCCTGGCCGCGGTCAACGCCGCGGTGCGCGAGGAAACCGCCAACC
GTGGGGTGACCATGATGGGCAGCACTGTGGTGCTGCTGGCGGTACGCGGGGCCCGGGCCGTGTGCCTGTG
GGCCGGCGATAGCCGCCTGTACCGGTTGCGGGACGAACAGCTGGAAGGCATTTCCCGGGACCACAGCTAC
GTCCAGGACCTGCAGGACAGCGGCCTGCTCAGCGAGGCCGAGGCGCGGGTGCACCCGCGGGCCAACATCG
TGACCCGGGCGATTGGCGTCGAGGCCCAGCTGGAGCTGTCCCAGATTGACCTGCAGGTGCAGGACGGCGA
CACCTTCCTGCTGTGCAGCGACGGCCTGAACAAGACCGCCGAGGACTTTGAGCTGCGTGACGTGCTCAGC
CACAGCGAGCCCAATGACGTGGTGCGCAGCCTGATCCACCTGGGCCTGACCCGGGGCGCTCCGGACAACA
TCACCGCCATCGTGATCAAGGCCGCAGGACACTGA
 Primer design