SecReT6
Protein ID: 501683445
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60390
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6697331..6697984 [-]
Producthypothetical protein
NoteTagF
UniProt IDR4RQ12
KEGG IDpprc:PFLCHA0_c60390
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.80E-50, Aligned region: 5..142
Protein Sequence: 217 a.a.     [Download]
>gi|501683445|ref|YP_008003271.1| hypothetical protein PFLCHA0_c60390 [Pseudomonas protegens CHA0]
MTAPGLYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQNALGEQWLNAYLISPLWRFALAPGVCGPQ
AAVGVVMPSIDRVGRYFPLTVAALLEPEADLASLVGGPEQWFEQVEELLLATLEEGASFEALEEGLQALG
APSPASRIEGSHYAGLQRFYVSDPQARGAVLAAQACAGSSAWWGRGSQYISPMLLRCQGLPPASEFAQFL
LGQEGAV
 
Nucleotide Sequence: 654 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6697984-6697331 Pseudomonas protegens CHA0, complete genome
ATGACGGCGCCGGGCCTGTACGGCAAGTTGGCCAGCCGCGGCGATTTTGTCAGCCGTGGCCTGCCGCAGA
GTTTCATCGGCCCCTGGGACAGTTGGCTGGCGGCGGGGCTGCTGGCCAGCCAGAACGCCCTGGGTGAGCA
GTGGCTGAACGCCTACCTGATCAGCCCGTTGTGGCGCTTCGCCCTGGCCCCCGGGGTCTGCGGGCCCCAG
GCGGCGGTCGGGGTGGTGATGCCGAGCATCGACCGGGTGGGGCGCTATTTCCCCCTGACCGTGGCTGCGC
TGCTGGAGCCCGAGGCTGACCTGGCTTCGTTGGTCGGCGGCCCGGAGCAGTGGTTCGAACAGGTGGAAGA
GCTGTTGCTGGCGACCCTGGAAGAGGGCGCCAGTTTCGAAGCCCTGGAAGAGGGCTTGCAGGCCCTGGGC
GCGCCAAGCCCGGCCAGCCGGATCGAAGGCAGCCACTACGCCGGCCTGCAGCGGTTTTACGTCAGCGATC
CACAGGCCCGGGGCGCGGTACTCGCGGCCCAGGCCTGCGCGGGATCGAGTGCCTGGTGGGGGCGCGGTTC
GCAGTACATCAGCCCAATGCTGTTGCGCTGCCAGGGCTTGCCGCCGGCCAGTGAATTTGCGCAATTTTTG
CTCGGACAAGAGGGTGCCGTCTAA
 Primer design