SecReT6
Protein ID: 501683446
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60400
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6697981..6701487 [-]
Producthypothetical protein
NoteTssM
UniProt IDR4RTT7, R4RTT7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 83..122
ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 188..448
ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 700..743
ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 780..821
IcmF-related [PF06761], Evalue: 7.60E-91, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 2.40E-40, Aligned region: 905..1026
AAA_19 [PF13245], Evalue: 0.0043, Aligned region: 61..82
AAA_19 [PF13245], Evalue: 0.0043, Aligned region: 124..141
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 606..651
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 769..809
Protein Sequence: 1168 a.a.     [Download]
>gi|501683446|ref|YP_008003272.1| hypothetical protein PFLCHA0_c60400 [Pseudomonas protegens CHA0]
MKAFFSFVIRWVIPLLGLIALSLIIWFIGPLLEFLVPEGRRWALIIFIFALWIGYRVFCIIQTRRHAAKV
LQSLAADTPPDPDSVATAEELAALRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSHATVDKAAWLGFLDLLKTQRSRR
PIDGAFVAISLSDLLLGSEAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDSLSKEE
RAQVWGMTFALDDGKSGDSPLAHLPAELAALEQRLNERLVERLQQERDPARRDLIYGFPQQFAALKESLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQTGTGRSYFIEKLFSAV
AFAERGLVGVNPKVERRRKWIARGALAGTVALVLVVSTLWIISYRANQAYIAQVDQRVGPVRQDVQNLSP
AQRDVLAVLPLLNATRHLAGDAPGWAEGLGLYQGDMLEAESASVYRKLLVAVFAPRLMTRIEEQLHSGGN
SDFLYEGLKAYLMLADSEHYDPDFIKAWITLDWDHTLARDLPPDQRQALTGHLQALFEKHPPNARLDQRL
IDDLRRQLQQLPVAQRVYDRVKRAKLPDGVPDFRLSEAGGRDAALVFTRKSGKPLSEPLSGLFTAKGYRQ
GFLLASLNQAGTLAEEQWVLGRDQADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADV
LRILSGPTSPLKKLLVAVAKETDLQQEERLLAAQGQKVEGGVDQLKQRLGTLLGQEQSANPAAVASSEDP
VSAHFAELNSLVSKGEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQASAAAARVSLTAERQP
PVVQGLVKSVVGSTTNTMMGGVRNQLNAAWVSEVVNVYRQSLSGRYPMSPGSSRDATLEDFGQFFGTGGV
MDNYFRKYLQPYVNTSTTTWSWQPGAAQKLGISPGVLQTFQRASNIRDAFFRSSGGTQPAVRFELKPVAM
DADISQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRLSIMPPSATGRSGITLDGPWAWFRLLEQSD
LTATNSPDRFNLRLRVDGASISYELRASSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3507 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6701487-6697981 Pseudomonas protegens CHA0, complete genome
GTGAAGGCGTTTTTCAGTTTTGTGATTCGCTGGGTGATCCCGCTGCTGGGGCTGATCGCCCTGAGCCTGA
TCATCTGGTTCATTGGCCCGTTGCTGGAGTTCCTGGTACCGGAAGGCCGGCGTTGGGCGCTGATCATTTT
CATCTTCGCGCTGTGGATCGGCTACCGGGTGTTTTGCATCATCCAGACCCGTCGGCATGCGGCCAAGGTC
TTGCAGAGCCTGGCCGCCGACACCCCGCCGGACCCGGACAGCGTGGCCACTGCCGAGGAACTGGCCGCCC
TGCGCCAGCGCATGGACGAAGCCCTGGCGCTGCTGAAGAAGGCCAAGCTCGGCGGTGACGAGCGACGCAA
TCTCTACGAGCTGCCGTGGTACGTGATCATCGGTCCGCCGGGTTCCGGCAAGACCACCGCACTGGTCAAT
TCCGGCCTGCATTTCCCCCTGGCCGCCCAGTTGGGCGCCGGTGCCGTACGCGGCGTGGGCGGCACCCGCA
ACTGCGACTGGTGGTTCACCGACCAGGCCGTGCTGCTCGATACCGCCGGCCGCTACACCACTCAGGACAG
CCATGCCACGGTGGACAAGGCAGCCTGGCTGGGCTTTCTCGACCTGCTGAAAACCCAGCGCTCGCGGCGG
CCGATCGATGGCGCCTTCGTTGCCATCAGCCTCTCCGACCTGTTGCTCGGCAGCGAAGCGGAGCGCGCTG
CCCACGCCGCAGCGATCCGCCTGCGGATCCAGGAGCTGTACACCCAGCTGGGAGTGCGCTTCCCGATCTA
CCTGATGCTCACCAAGCTCGATCTGGTGCCGGGTTTCATGGAGTTCTTCGACTCCCTGAGCAAGGAAGAG
CGGGCCCAGGTCTGGGGCATGACCTTCGCCCTGGACGACGGCAAGAGCGGTGACAGCCCCCTGGCCCACC
TGCCGGCGGAACTGGCGGCCCTGGAGCAGCGGCTCAACGAGCGCCTGGTGGAACGCCTGCAGCAGGAACG
CGACCCGGCGCGGCGCGACCTGATCTACGGCTTCCCGCAGCAGTTCGCAGCGCTCAAGGAATCCTTGCAG
AGCTTCCTGGAAGGGGTGTTCAAGCCCAATGCCTTCGAAGAGCGGGTACTGCTGCGCGGGGTGTACTTCA
CCAGCGGCACCCAGGAAGGCAGCCCGATCGACCGCCTGATCGGCGCCATGGCCCAGAGCATGAACCTGGA
CCGCCAGCACCTGGCGCGGCAGACCGGCACCGGGCGCAGCTACTTCATCGAGAAGCTGTTCAGTGCCGTG
GCCTTTGCCGAGCGCGGGCTGGTGGGGGTCAACCCCAAGGTCGAGCGCCGGCGCAAATGGATCGCCCGTG
GCGCCCTGGCTGGCACCGTAGCCCTGGTGCTGGTGGTCAGCACCTTGTGGATCATCAGCTACAGGGCCAA
CCAGGCCTACATTGCCCAGGTCGACCAGCGCGTCGGCCCGGTGCGCCAGGACGTGCAGAACCTCAGCCCG
GCCCAGCGCGATGTGCTGGCGGTGCTGCCGCTGCTCAACGCCACCCGCCACCTGGCCGGCGACGCCCCGG
GCTGGGCCGAAGGCCTGGGCCTGTACCAGGGCGACATGCTCGAAGCCGAGTCCGCCAGCGTCTATCGCAA
GCTGTTGGTGGCGGTGTTCGCCCCACGGCTGATGACCCGCATCGAAGAGCAACTGCACAGCGGCGGCAAC
TCGGACTTCCTCTACGAGGGGCTCAAGGCCTACCTGATGCTGGCGGACAGCGAGCACTACGACCCGGACT
TCATCAAGGCCTGGATCACCCTGGACTGGGATCACACCTTGGCCCGCGACCTGCCGCCGGACCAGCGTCA
GGCCCTGACCGGGCACCTGCAGGCGCTGTTCGAAAAACACCCACCGAACGCGCGCCTGGACCAGCGCCTG
ATCGACGACCTGCGCCGCCAGCTGCAACAGCTGCCGGTGGCCCAGCGGGTGTATGACCGGGTCAAGCGCG
CCAAGCTGCCGGACGGCGTGCCGGACTTTCGCCTCAGCGAGGCCGGTGGCCGTGACGCCGCGCTGGTGTT
CACCCGCAAGAGCGGCAAGCCGTTGAGCGAGCCCCTGAGCGGGCTGTTCACCGCCAAGGGCTACCGCCAG
GGCTTCCTCCTGGCCAGCCTCAACCAGGCAGGCACCCTGGCGGAAGAACAGTGGGTGCTGGGTCGCGATC
AGGCCGACCAGCAGAACGTCGCCAGCCTTGCCGCCGACGTGCGCCGCCTGTACTTCCAGGATTACCTGCG
CCAGTGGGACGCCTTGCTGGCGGACATCGACTTCGTGCCGATCACCAGCGTGGCCCAGGCCGCCGACGTG
CTGCGGATTCTGTCCGGGCCCACTTCGCCGCTGAAGAAACTGTTGGTGGCCGTGGCCAAGGAAACCGACC
TGCAACAGGAAGAACGCCTGCTGGCGGCCCAGGGCCAGAAGGTCGAGGGCGGTGTGGACCAGCTCAAGCA
ACGCCTGGGTACCCTGCTGGGCCAGGAACAGTCGGCCAACCCGGCTGCCGTGGCCAGCAGCGAAGACCCG
GTGAGCGCGCACTTCGCCGAACTCAACAGCCTGGTGAGCAAGGGCGAGGGCGAGCCGGCGGCCATCGACG
GCCTGCTGGCGGACATGAACGCCCTGTACGTGCAGGTCAGCGCCATGGTCGGGGCCAGCGGCGACGCGCT
GCTGGGCGAGGCCAAGAACCAGGCCAGCGCCGCTGCGGCGCGGGTCAGCCTGACCGCCGAGCGCCAGCCT
CCGGTGGTCCAGGGGCTGGTCAAGTCGGTGGTGGGCTCCACCACCAACACCATGATGGGCGGGGTGCGCA
ACCAGCTGAACGCGGCCTGGGTCAGCGAAGTGGTGAACGTCTATCGCCAGTCCCTGAGCGGCCGTTACCC
GATGTCGCCGGGCAGCTCCCGGGACGCGACCCTGGAAGACTTCGGCCAGTTCTTCGGCACCGGCGGGGTG
ATGGACAACTACTTCCGCAAGTACCTGCAGCCCTACGTCAACACCTCGACCACCACCTGGAGCTGGCAGC
CAGGCGCGGCGCAGAAGCTGGGGATTTCCCCTGGCGTGCTGCAGACCTTCCAGCGCGCTTCGAACATTCG
CGACGCCTTCTTCCGCTCCAGTGGCGGTACCCAGCCGGCCGTGCGTTTCGAACTCAAACCGGTGGCGATG
GACGCCGATATCAGCCAGTTCCTCCTCGACCTGGACGGCCAGCAACTGAGCTACGACCACGGCCCGAGCC
GGCCGGTGGCCATGCAATGGCCCAACCCGGGGAGCATCGGCGTGGTGCGCCTGTCGATCATGCCGCCTTC
GGCCACCGGGCGTTCCGGGATCACCCTGGATGGCCCCTGGGCCTGGTTCCGCCTGCTGGAGCAGTCGGAC
CTGACCGCCACCAATTCGCCGGACCGCTTCAACCTGCGGCTACGGGTGGACGGTGCGAGCATTTCCTACG
AGCTGCGGGCCAGCAGCGCCTTCAACCCGTTCAAGAGCCGGGTGCTCAGTGGCTTCAGCCTGCCGGAGCG
GCTATGA
 Primer design