SecReT6
Protein ID: 501683447
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60410
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6701484..6702809 [-]
ProductOmpA family protein
NoteTssL
UniProt IDR4RTM1, R4RTM1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-70, Aligned region: 58..263
OmpA [PF00691], Evalue: 3.40E-16, Aligned region: 331..429
DUF883 [PF05957], Evalue: 0.0003, Aligned region: 76..131
DUF883 [PF05957], Evalue: 0.0003, Aligned region: 195..260
DUF883 [PF05957], Evalue: 0.0003, Aligned region: 328..363
Protein Sequence: 441 a.a.     [Download]
>gi|501683447|ref|YP_008003273.1| OmpA family protein [Pseudomonas protegens CHA0]
MHPFDDSPGQPSPPNDRTQFMPRPGGRAPEPGRPAAAPAPSLAMPAAPLPAGQARGLNPLESAAGPLLAL
LTRLRSTLAHPAPASLRAQLLAYLRQFEERAEAAGVPRNDVLLARYALCTALDEAVLSTPWGSTSDWGKQ
SLLITVHNEAWGGEKVFQLLEHCLQSPRERLYLLELLYLCMCLGFEGRYRVMIDGRSQLEALRERTAATI
RSARGEHERELSPHWRGVSVARDRLAQFMPPWVGIAIGVALLLALLFGLRLKLAADAEPVFKNIHALGEI
PVQTLDRPVIQPKIVERPRLAGFLAEDIKAGRVAVEDAVDRSVVTIRGDELFASASASILDDYQPLMLRI
ADAVRKVKGQVRITGHSDNRPIATLRFPSNWKLSQARAESVLQILAAKTGQPERFSAEGRSDTEPLATNA
TAEGRARNRRVEISVLAEGVE
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6702809-6701484 Pseudomonas protegens CHA0, complete genome
ATGCATCCTTTCGACGATTCGCCAGGGCAGCCGTCCCCGCCCAACGACCGTACCCAATTCATGCCGCGCC
CCGGTGGCCGTGCTCCCGAGCCCGGGCGCCCGGCTGCTGCGCCCGCGCCGTCGCTGGCCATGCCAGCGGC
GCCGCTGCCGGCCGGCCAGGCCCGTGGCCTGAACCCCCTGGAAAGCGCCGCGGGCCCGCTGCTGGCCTTG
CTCACAAGGTTGCGCAGCACCCTGGCGCACCCGGCGCCGGCCAGCCTGAGGGCGCAACTGCTGGCCTACC
TGCGCCAGTTCGAGGAGCGCGCGGAAGCCGCCGGCGTGCCGCGCAACGACGTGCTGCTGGCGCGCTATGC
GCTCTGTACTGCCCTGGATGAAGCCGTGCTGAGCACGCCCTGGGGCAGCACCAGCGACTGGGGCAAGCAG
AGCCTACTGATCACCGTGCACAACGAGGCCTGGGGCGGCGAGAAGGTCTTCCAGCTGCTGGAGCACTGCC
TGCAAAGCCCGCGCGAGCGCCTGTACCTGCTGGAGCTGTTGTACCTGTGCATGTGCCTGGGTTTCGAAGG
CCGCTACCGGGTGATGATCGATGGCCGCAGCCAGCTCGAGGCCCTGCGCGAGCGCACCGCGGCCACCATC
CGCAGCGCCCGTGGCGAGCACGAGCGCGAGCTGTCGCCACACTGGCGCGGGGTCAGCGTGGCTCGTGACC
GGCTGGCCCAGTTCATGCCGCCTTGGGTCGGCATCGCCATCGGCGTGGCCCTGCTCCTGGCGCTGCTGTT
CGGCCTGCGCCTGAAACTGGCGGCGGACGCCGAGCCGGTGTTCAAGAACATCCATGCCCTGGGCGAGATC
CCGGTGCAGACCCTGGACCGCCCGGTGATCCAGCCGAAGATTGTCGAGCGTCCGCGCCTGGCGGGCTTCC
TCGCCGAGGACATCAAGGCCGGGCGGGTGGCGGTGGAAGACGCCGTCGATCGTTCGGTGGTGACCATCCG
TGGCGACGAGCTGTTCGCCTCGGCCAGCGCCAGCATCCTCGACGACTACCAGCCGCTGATGCTGCGCATC
GCCGACGCGGTGCGCAAGGTCAAGGGCCAGGTGCGGATCACCGGCCACAGCGACAACCGACCGATCGCCA
CCTTGCGCTTCCCGTCCAACTGGAAGCTGTCCCAGGCCCGCGCCGAGTCGGTGTTGCAGATCCTCGCGGC
GAAGACCGGGCAGCCGGAGCGCTTCAGCGCCGAAGGCCGCAGTGACACCGAGCCGCTGGCAACCAATGCC
ACCGCCGAAGGGCGGGCACGTAATCGTCGGGTAGAAATCAGCGTATTGGCGGAGGGGGTCGAGTGA
 Primer design