SecReT6
Protein ID: 501683448
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60420
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6702816..6704150 [-]
Producthypothetical protein
NoteTssK
UniProt IDR4REP9, R4REP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|501683448|ref|YP_008003274.1| hypothetical protein PFLCHA0_c60420 [Pseudomonas protegens CHA0]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSTGAWGFSELRIDQGLLAQGKLAIVSARGLLP
DGTPFNIPHDDLAPSPLCIDDNLRDGLVYLALPLKRAGARDTVDEGEELGGARYLSQVREVRDDNAPFEN
RAPVAVGSRALRLLTAQDGLSDYAAIGVVRVKEKRADRALVLDDSYIPPVLDVAASKPLSAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLVNHLSQISPLHPERLFSELVSLAGEFSTFTHSA
RRPEQYPQYQHDELAMSFAPVMQALREALSMLIDSKATPIPIVEKAYGVHVAMLADRTLLENASFILVVR
ADVPGETLRGRFAQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSEHWKQLVH
SGGFAFHVAGEFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6704150-6702816 Pseudomonas protegens CHA0, complete genome
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATTGGAACCCAGCACTTCCAGCAGCATG
ACCGTTACCTGGAAAACCTCATCGACGCCCGCAGCCGCCCGCTGTCGACGGGAGCCTGGGGGTTCTCCGA
GCTGCGTATCGATCAGGGCCTGCTGGCCCAGGGCAAGCTGGCCATCGTCAGCGCCCGTGGCCTGCTGCCT
GACGGCACGCCGTTCAACATTCCCCATGACGACCTGGCGCCCAGCCCGTTGTGCATCGACGACAACCTGC
GTGACGGCCTGGTGTACCTGGCGCTGCCCCTCAAGCGCGCCGGCGCCCGGGACACCGTGGACGAGGGCGA
AGAGCTGGGCGGTGCCCGCTACCTGAGCCAGGTGCGCGAGGTGCGTGACGACAACGCACCGTTCGAGAAC
CGCGCGCCGGTGGCCGTGGGCTCTCGGGCCCTGCGCCTGCTCACCGCCCAGGACGGCCTCAGCGACTACG
CCGCCATTGGCGTGGTGCGGGTCAAGGAGAAACGCGCCGACCGTGCTCTGGTGCTGGACGACAGCTACAT
TCCGCCGGTGCTGGACGTGGCCGCGTCCAAGCCGTTGAGCGCCTTTCGCAGCGAGCTGCTGGGCCTGCTG
CACCAGCGCGGCGAGGCCCTGGCCGGGCGCGTGGTGGCATCGGGCGCGGGGGGCGCTTCGGAAATCGCCG
ACTTCATGCTCCTGCAACTGGTGAACCGCGCCCAGCCCCTGGTCAACCACCTGAGCCAGATCAGCCCGCT
GCACCCCGAGCGCCTGTTCAGCGAGCTGGTGAGCCTGGCCGGCGAGTTCTCGACCTTCACCCACAGCGCC
CGGCGCCCTGAGCAATACCCGCAGTACCAGCACGATGAGCTGGCCATGAGTTTCGCCCCGGTGATGCAGG
CCCTGCGTGAAGCGCTGTCGATGCTGATCGACAGCAAGGCAACGCCGATCCCCATCGTCGAGAAAGCCTA
CGGCGTACACGTGGCGATGCTGGCCGACCGCACCCTGCTGGAGAACGCCAGCTTCATCCTGGTGGTGCGT
GCCGACGTGCCGGGCGAAACCCTGCGCGGGCGCTTTGCCCAGCAGAGCAAGGTGGGTTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAGCTGCCGGGCATCGGCCTGCTGCCGCTGCCGGTGGCGCCGCGGCAACT
GCCGTACCACGCAGGCTCGACCTACTACGAGCTGGACCGTGGCAGCGAGCACTGGAAACAACTGGTTCAC
TCCGGCGGCTTCGCGTTCCACGTCGCGGGAGAATTCCCGGGCTTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA
 Primer design