SecReT6
Protein ID: 501683449
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60430
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6704166..6704672 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDR4RHA9, R4RHA9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.80E-35, Aligned region: 11..152
Protein Sequence: 168 a.a.     [Download]
>gi|501683449|ref|YP_008003275.1| putative lipoprotein [Pseudomonas protegens CHA0]
MIQRLLTLVAMLVLAACAKDTPPPGEPAKEAPGATTVELHFQAVSGLNPGPDGQSTPVRVRIFELKNPAT
FMRADYFALAERAPATLGPDLIDQDEVLVKPGDQFTLKRTLDPATRQVGLLVGYREVDQALWRVGVNTAQ
RLSNQYQIVLDVRAVSAELVASPSSPAQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6704672-6704166 Pseudomonas protegens CHA0, complete genome
ATGATTCAACGATTGCTGACATTGGTTGCCATGCTGGTACTGGCGGCCTGTGCCAAGGACACACCACCTC
CCGGCGAACCGGCCAAGGAAGCGCCCGGCGCCACGACTGTGGAGCTGCATTTCCAGGCGGTCAGCGGGCT
CAACCCCGGGCCTGATGGCCAGAGCACGCCGGTGCGGGTACGGATCTTCGAGCTGAAGAATCCGGCCACC
TTCATGCGCGCCGACTACTTCGCCCTGGCGGAGCGGGCGCCGGCTACCCTCGGCCCGGACCTGATCGACC
AGGATGAAGTGCTGGTCAAGCCCGGCGACCAGTTCACCCTCAAGCGCACCCTGGACCCGGCCACCCGTCA
GGTCGGCCTGCTGGTGGGCTATCGCGAAGTGGACCAGGCCCTGTGGCGGGTCGGGGTCAACACCGCGCAG
CGCCTGAGCAACCAATATCAGATCGTCCTCGACGTCCGCGCGGTCAGCGCCGAGCTCGTGGCATCCCCAT
CCAGCCCTGCCCAATAG
 Primer design