SecReT6
Protein ID: 501683450
SecReT6 ID764
T6SS typei3
Gene symbolfha
Locus tagPFLCHA0_c60440
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6704737..6706221 [-]
Producttype VI secretion protein Fha
NoteFha
UniProt IDR4RQ17
KEGG IDpprc:PFLCHA0_c60440
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-14, Aligned region: 30..97
Protein Sequence: 494 a.a.     [Download]
>gi|501683450|ref|YP_008003276.1| type VI secretion protein Fha [Pseudomonas protegens CHA0]
MSLCLTITSYHKITPGQCPEKLMDQGMMAIGRSSDNDWVLPDPERLVSARHCVIQYKDGRYYLTDNSTNG
VELVRAGIRMRRGSSEPLEDGEVIRIGDYEISARIDFSLNRPGAEPFSGDSSNSFEALMGRQAASPTPIE
PISMAPVAHFQGASAQDTFPDLFDFLAPSATPPATQPDHVPAEQHDFRPPTPTAVPQPVAPPEPSAPQGG
AVIPEDWDLFGSTPASPAPVPSAPPVVAPPVVAAAPIAHQASFAAEPAQPQPQPQPQPQPIAQAPVAPVV
SEVELAPVVTPAPAPVAPQGDLLQAFLRGAGLDQLRIEPQQAQAQMESLGRSYRLMVEGLIDVLRARSSL
KGEFRMQQTMIRPVENNPLKFAPNVDEAMLLLLRHSNQAFMAPDQAVQDSFDDLRAHQLAVMAGVEAAIK
HLLGRFEPTELEARMARPGGLGNLFSGSRQAQNWQQFTALYKQISQEAQDDFQDLFGREFSRAYEEHTHR
LRRS
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c6706221-6704737 Pseudomonas protegens CHA0, complete genome
ATGTCGCTGTGTTTGACTATCACTAGTTATCACAAGATTACCCCTGGTCAATGCCCTGAAAAACTAATGG
ACCAGGGAATGATGGCAATTGGCCGCAGTTCCGATAATGACTGGGTACTTCCTGATCCCGAACGCTTAGT
TTCCGCGCGGCACTGTGTCATCCAATACAAGGATGGCCGTTATTATTTGACCGATAACAGTACTAATGGT
GTGGAGTTAGTCCGTGCCGGTATTCGTATGCGCCGGGGTAGCAGCGAGCCTCTGGAAGATGGCGAGGTTA
TTCGCATTGGCGATTATGAAATCAGTGCGCGCATCGATTTCAGTCTGAACCGCCCGGGGGCTGAACCCTT
TTCCGGGGACAGCTCCAATAGTTTCGAGGCGCTGATGGGGCGTCAGGCGGCTTCGCCGACCCCCATCGAA
CCGATTTCCATGGCCCCGGTGGCGCACTTCCAGGGTGCCTCGGCCCAGGACACCTTTCCCGATCTGTTCG
ACTTTCTCGCCCCCAGCGCGACCCCGCCGGCCACCCAGCCGGACCACGTGCCGGCCGAGCAGCACGATTT
TCGCCCGCCGACCCCCACCGCGGTGCCCCAGCCCGTGGCACCGCCTGAGCCATCGGCGCCCCAGGGCGGG
GCGGTGATTCCGGAGGACTGGGACCTGTTCGGCTCGACGCCCGCAAGCCCTGCGCCAGTGCCCAGTGCGC
CGCCCGTGGTTGCCCCGCCGGTGGTTGCTGCCGCGCCGATTGCCCACCAGGCCTCGTTCGCGGCAGAACC
CGCGCAGCCGCAGCCGCAGCCGCAGCCGCAGCCGCAGCCGATCGCCCAGGCGCCCGTGGCACCGGTGGTT
TCCGAAGTGGAGCTGGCTCCTGTTGTCACGCCCGCGCCGGCCCCGGTCGCCCCCCAGGGGGATCTGCTCC
AGGCCTTCCTGCGCGGGGCCGGGCTCGATCAACTGCGTATCGAGCCGCAGCAGGCCCAGGCCCAGATGGA
AAGCCTGGGTCGCAGCTACCGGTTGATGGTCGAGGGCCTGATCGATGTGTTGCGTGCCCGCAGCAGCCTC
AAGGGCGAGTTCCGCATGCAGCAGACGATGATCCGCCCGGTGGAAAACAACCCGCTGAAGTTCGCCCCCA
ATGTGGACGAGGCGATGCTCCTGCTGCTGCGTCACAGCAACCAGGCATTCATGGCTCCGGATCAGGCCGT
GCAGGACAGTTTCGATGACCTGCGGGCGCACCAGCTGGCGGTCATGGCCGGTGTGGAAGCGGCCATCAAG
CACCTGCTGGGGCGCTTCGAGCCCACTGAACTGGAAGCTCGCATGGCTCGCCCCGGCGGCCTGGGCAACC
TGTTCAGCGGCTCGCGCCAGGCGCAGAACTGGCAGCAGTTCACTGCACTCTACAAACAGATTTCCCAAGA
GGCCCAGGACGATTTCCAGGACCTCTTCGGTCGTGAGTTCAGCCGCGCCTATGAAGAACACACCCACCGG
CTGCGCCGTTCCTGA
 Primer design