SecReT6
Protein ID: 501683451
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60450
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6706626..6707633 [+]
Producthypothetical protein
NoteTssA
UniProt IDR4RTU2, R4RTU2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-19, Aligned region: 48..108
Protein Sequence: 335 a.a.     [Download]
>gi|501683451|ref|YP_008003277.1| hypothetical protein PFLCHA0_c60450 [Pseudomonas protegens CHA0]
MLLAAVSATSPCGEDLEYDADFLHLERAAQGQPERSMGDSILPAEPPDWRSIQQQSLDLLARSKDLRITH
FLLQSTLALEGLPGLATSLELIDGLLRDYWADLHPRLDADDDNDPTVRINALAGLASDTTIGLLREAILT
RSRTFGPVSLRAALNAAGLQHFSGESLGSDHLAGALQDSDPEHLDAIRSALNAARSAAESIEKQVSEQVG
SASGVDLTALKQPLRLALQVLGQHAPQGAQNAVEEHADGPSTEEPGAPAAPAPVRISGEISSREDVLRSL
DRLLAYYSRHEPSSPLPVLLNRAKNLVNADFAAIVRNLIPDGMSQFENLRGPESD
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6706626-6707633 Pseudomonas protegens CHA0, complete genome
ATGTTGCTCGCCGCGGTTTCAGCAACTTCGCCTTGTGGCGAAGACCTGGAATATGACGCGGATTTCTTGC
ACTTGGAGCGGGCCGCACAGGGCCAGCCCGAGCGCAGCATGGGCGACTCGATCCTGCCGGCCGAGCCGCC
GGACTGGCGCAGCATCCAGCAACAGAGCCTGGACCTGCTGGCGCGCAGCAAAGACCTGCGCATCACCCAC
TTCCTCCTGCAGAGCACCCTGGCCCTCGAAGGCCTGCCGGGCCTGGCCACCAGCCTCGAACTGATCGACG
GCCTGCTCCGGGATTACTGGGCGGACCTGCATCCGCGCCTGGACGCCGACGACGACAACGACCCCACGGT
GCGTATCAACGCCCTGGCCGGCCTGGCGTCCGACACCACCATCGGCCTGCTCCGCGAAGCCATCCTGACC
CGTTCCCGGACCTTCGGCCCGGTGAGCCTGCGAGCCGCGCTGAACGCCGCCGGCCTGCAGCACTTTTCCG
GCGAGAGCCTGGGCTCCGACCACCTGGCCGGCGCCCTGCAAGACAGCGACCCCGAGCACCTGGATGCGAT
TCGCAGCGCCTTGAACGCAGCCCGCTCGGCGGCCGAAAGCATCGAGAAACAGGTCAGCGAACAAGTAGGC
TCGGCCAGCGGTGTAGACCTCACGGCCCTCAAGCAACCCCTGCGCCTGGCGCTGCAGGTGCTGGGCCAGC
ACGCCCCGCAAGGCGCGCAGAACGCGGTCGAGGAACACGCCGATGGGCCGTCCACCGAAGAGCCCGGTGC
GCCCGCAGCGCCAGCCCCGGTACGGATTTCCGGCGAGATCAGCAGCCGCGAAGACGTGCTGCGCAGCCTT
GACCGGCTGCTGGCCTACTACAGCCGCCACGAGCCTTCGAGCCCGTTGCCGGTGCTGCTCAACCGGGCCA
AGAACCTGGTCAACGCCGACTTCGCGGCCATCGTGCGCAATCTGATTCCCGACGGCATGTCCCAATTTGA
AAACCTGCGCGGCCCTGAATCCGACTAA
 Primer design