SecReT6
Protein ID: 501683452
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60460
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6707715..6708230 [+]
Producthypothetical protein
NoteTssB
UniProt IDR4RTM5, R4RTM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-59, Aligned region: 10..163
Protein Sequence: 171 a.a.     [Download]
>gi|501683452|ref|YP_008003278.1| hypothetical protein PFLCHA0_c60460 [Pseudomonas protegens CHA0]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPVEPLAAVADRKFLEIDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPADSEPNA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6707715-6708230 Pseudomonas protegens CHA0, complete genome
GTGGCGAAGCAAAGTTCTCAAAAGTTCATCGCGCGCAACCGCGCGCCCCGGGTGCAGATCGAGTACGACG
TCGAACTCTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTCATGGGCGTGATGGCCGACCTCGCCGG
CAAGCCCGTGGAGCCCCTGGCGGCCGTGGCCGATCGCAAGTTCCTGGAAATCGACGTCGATAACTTCGAC
TCGCGCCTCAAGGCCATGCAGCCTCGGGTGGCCTTCCACGTGCCCAACGAACTGACCGGCGAAGGCAACC
TGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCGGCGGCCGTGGCGCGCAAGGTCGATTC
GTTGAACCAGTTGCTGGAAGCCCGCACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACCGGC
GCCGAAGAAATCATCATGAAAGCCATCAAGGATCCGGCGTTGCTCCAGGCCCTGGCCAGTGCGCCAAAGC
CTGCTGACTCCGAGCCGAACGCGTAA
 Primer design