SecReT6
Protein ID: 501683453
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60470
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6708247..6709740 [+]
Producthypothetical protein
NoteTssC
UniProt IDR4REQ5, R4REQ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-196, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.0007, Aligned region: 18..79
Protein Sequence: 497 a.a.     [Download]
>gi|501683453|ref|YP_008003279.1| hypothetical protein PFLCHA0_c60470 [Pseudomonas protegens CHA0]
MTELMRDNQAQPGATEQASEFASLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESII
AAIDAKLTAQVNQVIHHPEFQKLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTAWDQS
PLFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQELS
NPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWAN
AAYAMAVNINRSFKHFGWCSRIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFM
PLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEM
QRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSK
LPSAKGA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6708247-6709740 Pseudomonas protegens CHA0, complete genome
ATGACCGAATTGATGCGTGACAATCAGGCGCAACCCGGCGCCACCGAGCAGGCCAGCGAATTCGCATCGC
TGCTGCTGCAGGAATTCAAGCCCAAGACCGAGCGTGCTCGCGAAGCCGTGGAAACCGCGGTGCGGACCCT
GGCCGAACAGGCCCTGGCGCAGACCGACCTGGTGTCCAACGACGCCATCAAGTCGATCGAGTCGATCATC
GCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGGTGATCCATCACCCGGAATTCCAGAAGCTGG
AAAGCGCCTGGCGCGGCCTGCACTACCTGGTGAACAACACCGAGACCGACGAGCAGCTCAAGATCCGCGT
GCTCAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACGGCCTGGGACCAGAGC
CCGCTCTTCAAGAAGATGTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCTTACGGCTGCCTGGTGG
GCGACTACTACTTCGACCAGTCGCCACCGGATGTCGAGCTGCTGGGCGAGCTGTCCAAGGTTTGCGCCGC
CATGCACTCGCCGTTCATCGCCGCGGCTTCGCCGACCGTGATGGGCATGGGCTCGTGGCAGGAACTGTCG
AACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGTTGCGTGAATCGG
AAGACTCGCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCATACGGCGCCAAGACCGA
CCCGGTGGAAGCCTTCGCCTTCGAGGAAAACACCGACGGCGCCGACAGCTCCAAGTACACCTGGGCCAAC
GCCGCCTACGCCATGGCCGTGAACATCAACCGTTCGTTCAAGCATTTCGGCTGGTGCTCGCGGATCCGCG
GCGTGGAGTCCGGCGGCGAGGTGGAAAACCTCCCGGCCCACACCTTCCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAGATCGCCATCTCCGACCGTCGTGAAGCGGAACTGGCGAAGAACGGCTTCATG
CCACTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCCCAGTCGCTGCAGAAGCCGGCCG
AATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTTCGCCACTTG
CCGCTTCGCTCACTACTTGAAGTGCATCGTGCGCGACAAGATCGGCTCCTTCAAAGAGAAGGACGAGATG
CAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGTGATCCGGCGCACTCCACCGAAACCACCA
AGGCCCAGCACCCACTGGCCGCGGCGGAAGTGGTGGTCGAGGAAGTCGAAGGCAACCCCGGCTACTACAA
CTCGAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGGCTGACCGTGTCGTTGCGCCTGGTATCCAAA
CTGCCGTCCGCCAAGGGCGCCTAA
 Primer design