SecReT6
Protein ID: 501683455
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60490
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6710475..6711023 [+]
Producthypothetical protein
NoteTssE
UniProt IDR4RQ23, R4RQ23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.20E-23, Aligned region: 48..157
Protein Sequence: 182 a.a.     [Download]
>gi|501683455|ref|YP_008003281.1| hypothetical protein PFLCHA0_c60490 [Pseudomonas protegens CHA0]
MPAQSDPGANPLVTDIAARDRLQPSLLDRLTDDEPGNLKESPDKRVLSLSQLKASVLRDLAWLLNTTSLL
EADATLHTPAGTSVVNYGLPALAGYSASSIDIPALEALIHQAIATFEPRILRSTLRVRARTAPGEMNHNA
LSFEIEGDLWAQPMPLRLLLQTDMDLESGHVRVVHADSRRRS
 
Nucleotide Sequence: 549 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6710475-6711023 Pseudomonas protegens CHA0, complete genome
ATGCCTGCGCAATCCGATCCTGGAGCGAACCCCTTGGTAACCGACATCGCCGCCCGCGATCGCTTGCAAC
CCTCCCTGCTGGATCGTCTGACCGACGATGAACCCGGCAACCTGAAAGAAAGCCCGGACAAACGCGTGCT
GTCCCTGAGCCAGCTCAAGGCCTCGGTACTGCGCGACCTGGCATGGCTGCTCAACACCACTTCCCTGCTG
GAAGCCGACGCCACCCTGCACACCCCCGCCGGTACTTCGGTGGTCAACTACGGCCTGCCGGCCCTGGCCG
GGTACAGCGCTTCGAGCATCGATATCCCGGCCCTGGAGGCGCTGATCCACCAGGCCATCGCCACCTTTGA
GCCGCGCATCCTGCGCAGCACCCTGCGGGTACGCGCACGCACCGCGCCCGGGGAAATGAACCACAACGCC
CTGAGCTTCGAGATCGAAGGCGACCTCTGGGCCCAGCCGATGCCCCTGCGCCTGCTGCTGCAAACCGACA
TGGACCTGGAATCGGGCCACGTACGAGTAGTGCACGCCGACTCCCGGAGGCGCTCATGA
 Primer design