SecReT6
Protein ID: 501683456
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60500
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6711020..6712879 [+]
Producthypothetical protein
NoteTssF
UniProt IDR4RTU4, R4RTU4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-217, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|501683456|ref|YP_008003282.1| hypothetical protein PFLCHA0_c60500 [Pseudomonas protegens CHA0]
MNPRLLELYNQELHHVRESAAEFAKEFPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQADPDEGSLSSGFTLERDTSLRAALGRDTQTCCEYRTAHSVTLWP
LQVAQAEYFGNPSAVLGRLAASEPRAKAGLRLTLRTGAELPFNSLALDELPLYLNGNDEQPFRLYEQLLG
NVCAVFARAPGGDWVERLPPDALRSRGFDDRDAALPVVPQAFQGYRLLQEYFALPNRFLFVEFAQLGRAV
QRCAGQELELIVLFERFDQSLEGSVGTAQFVPFCTPAINLFPKRLDRIHLSDRVNEHHVIADRTRPMDFE
VHSLTAISGHGTGPEQPFLPFYAVRDPSRYGRDQSYYIVRREPRVLSSDQRRNGPRSTYIGSESFVSLVD
SQQAPYRHDLRQLGVSALCTNRDLPLFMNTGNGKTDFTLADSAPVQAIRCLAGPSRPRPSHAHDGKAWRL
ISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6711020-6712879 Pseudomonas protegens CHA0, complete genome
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCCGCGGAGTTCG
CCAAGGAATTCCCGAAGATCGCCAGCCGCCTGACCCTGTCGGGCATGGACTGCGCCGACCCCTATGTCGA
GCGCCTGCTGGAGGGCTTCGCCTACCTGACTGCCCGGGTGCAGCTCAAGCTCGACGCCGAGTACCCGACC
TTCACCCACAACCTGCTGGAGATCGCCTACCCGCACTACCTGGCACCGACCCCGTCGATGACCGTGGTGC
AGTTGCAGGCCGATCCCGACGAAGGTTCCCTGAGCAGCGGCTTCACCCTGGAGCGCGACACCAGCCTGCG
CGCCGCCCTGGGCCGCGATACCCAGACCTGCTGCGAATACCGCACCGCGCACTCGGTGACCCTGTGGCCA
CTGCAAGTGGCCCAGGCCGAATACTTCGGCAACCCGTCGGCAGTGCTCGGGCGCCTGGCCGCCAGCGAGC
CCAGGGCCAAGGCCGGGCTGCGCCTGACCCTGCGCACCGGCGCCGAACTGCCGTTCAACAGCCTGGCCCT
GGACGAGTTGCCGCTGTACCTGAACGGCAATGACGAACAGCCGTTCCGCCTCTACGAACAACTGCTGGGC
AACGTCTGCGCGGTGTTCGCCCGGGCCCCGGGCGGCGACTGGGTCGAGCGCCTGCCCCCGGACGCCCTGC
GCTCGCGCGGTTTCGACGACCGCGACGCGGCGCTGCCGGTGGTGCCCCAGGCCTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCCAACCGCTTCCTGTTCGTCGAATTCGCCCAGCTGGGGCGCGCGGTC
CAGCGCTGCGCCGGCCAGGAGCTGGAGCTGATCGTGCTCTTCGAGCGCTTCGACCAGAGCCTGGAAGGCA
GCGTCGGCACCGCTCAGTTCGTGCCCTTCTGCACCCCGGCGATCAACCTGTTTCCCAAGCGCCTGGACCG
TATCCACCTGTCCGACCGGGTCAACGAGCACCATGTGATCGCCGACCGCACCCGACCGATGGATTTCGAG
GTCCACTCGCTGACCGCCATCAGCGGCCACGGCACCGGCCCGGAACAGCCGTTCCTGCCGTTCTACGCCG
TGCGCGATCCATCCCGCTACGGCCGCGACCAGTCCTACTACATCGTCCGGCGCGAGCCGCGGGTGCTGTC
CAGCGACCAGCGTCGCAACGGCCCGCGCTCCACCTACATCGGCAGCGAATCCTTCGTCAGCCTGGTGGAC
AGCCAGCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGGGTCAGCGCGCTGTGCACCAACCGCGACC
TGCCACTGTTCATGAACACCGGCAACGGCAAGACCGACTTCACCCTGGCCGACAGCGCCCCGGTACAGGC
CATCCGCTGCCTGGCGGGCCCGAGCCGGCCGCGCCCCAGCCATGCCCACGACGGCAAGGCCTGGCGCCTG
ATCAGCCAGCTATCGCTGAACTACCTGTCCCTGAGCGAACAGGGCCAGGGCGCGGCGGCCCTGCGCGAAC
TGCTGCGGTTGTACGGCGACAGCAACGACGCGGCCCTGCAGTTGCAGATCGAGGGCCTGCGGGAAGTCAG
CAGCAAGGCGGTGACCCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGGGGCCTGGAGATCACC
CTGGAGTTCGATGAAAACGCGTTCCGCGGCACCGGGGTGTTTCTGCTCGGCGCGGTATTCGAGCGCTTCC
TGGCACGTTATGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGACGTCGTCCGACTCTTTGA
 Primer design