SecReT6
Protein ID: 501683457
SecReT6 ID764
T6SS typei3
Gene symbol-
Locus tagPFLCHA0_c60510
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6712894..6713895 [+]
Producthypothetical protein
NoteTssG
UniProt IDR4RTN0, R4RTN0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-111, Aligned region: 3..303
Protein Sequence: 333 a.a.     [Download]
>gi|501683457|ref|YP_008003283.1| hypothetical protein PFLCHA0_c60510 [Pseudomonas protegens CHA0]
MHAEPWEYDFFQALRRIECLSPQLPRFGHSVRLADDPLRLGQQADCSFAPATLASVTPGSDGAATRLEQF
FFGLGGPNGPLPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAWAEARPTVSHDRPDDDYWSAR
LAALSGRGMPSLLKQGLIADTAKLHYSGHLAAQTRYPDGLRAIISEYFGLPVQIEEYVGQWLELPERSRV
GVQSHQLGVDFCLGSHVWDRQHKFRIRLGPMKLDDYLGMLPDGQQFQELVAWAAEYLGFELDWDLNLVLL
KDEVPKLQLNGRQRLGFNTWLGQPGSDAKDLILARHYADLATTSRTPRSTEHG
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6712894-6713895 Pseudomonas protegens CHA0, complete genome
ATGCACGCCGAGCCTTGGGAGTACGACTTCTTCCAGGCCCTGCGGCGTATCGAATGCCTGTCGCCGCAAC
TGCCGCGCTTCGGTCACTCCGTGCGCCTGGCGGACGATCCGCTGCGCCTGGGACAGCAGGCCGACTGCAG
CTTCGCCCCGGCCACCCTGGCCTCGGTCACCCCCGGCAGCGACGGCGCCGCGACCCGCCTGGAGCAGTTC
TTCTTCGGCCTCGGCGGGCCCAACGGGCCGTTGCCGCTGCACATCACCGAATACGTGCGCGAGCGCCAGC
GCAACAACGCCGACAGCACCAGCAAGCGCTTTCTCGATGTGTTCCACCACCGCCTGCTGAGCCTGTTCTA
TCGGGCCTGGGCCGAAGCCCGACCGACGGTGAGCCACGATCGCCCGGACGACGACTACTGGTCGGCGCGG
CTGGCGGCGCTGTCGGGCCGGGGCATGCCCAGCCTGCTCAAGCAGGGTCTGATAGCCGACACCGCCAAGC
TGCATTACAGCGGCCACCTGGCGGCCCAGACCCGCTACCCGGACGGCTTGCGGGCGATCATCAGCGAGTA
TTTCGGCCTGCCGGTGCAGATCGAGGAATATGTCGGCCAGTGGCTGGAGTTGCCCGAACGCAGCCGGGTC
GGGGTGCAATCCCATCAGCTGGGGGTGGATTTCTGCCTGGGCAGCCACGTCTGGGACCGCCAGCACAAGT
TCCGCATCCGCCTCGGCCCGATGAAACTGGACGACTACCTGGGGATGCTGCCCGACGGCCAGCAATTCCA
GGAACTGGTGGCCTGGGCCGCCGAATACCTGGGCTTCGAGCTGGACTGGGACCTGAACCTGGTCCTGCTC
AAGGACGAAGTGCCCAAGCTGCAACTCAACGGCCGCCAGCGCCTGGGTTTCAACACCTGGCTCGGCCAAC
CCGGCAGCGATGCCAAGGATCTAATACTGGCCCGGCACTACGCCGACCTGGCCACTACCTCACGTACACC
AAGGAGCACAGAGCATGGGTGA
 Primer design