SecReT6
Protein ID: 501683458
SecReT6 ID764
T6SS typei3
Gene symbolclpV
Locus tagPFLCHA0_c60520
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6713888..6716563 [+]
Productprotein ClpV
NoteTssH
UniProt IDR4REQ8, R4REQ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 620..786
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 234..368
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 626..710
ClpB_D2-small [PF10431], Evalue: 7.20E-16, Aligned region: 48..61
ClpB_D2-small [PF10431], Evalue: 7.20E-16, Aligned region: 793..867
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 351..364
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 625..754
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 37..78
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 211..250
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 488..488
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 595..670
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 784..840
Sigma54_activat [PF00158], Evalue: 6.60E-07, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 6.60E-07, Aligned region: 624..743
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 64..98
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 356..396
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 623..646
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 687..708
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 623..650
Zeta_toxin [PF06414], Evalue: 4.70E-05, Aligned region: 234..249
Zeta_toxin [PF06414], Evalue: 4.70E-05, Aligned region: 620..665
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 234..253
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 627..650
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 813..856
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 285..318
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 625..646
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 696..707
AAA_19 [PF13245], Evalue: 0.00033, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00033, Aligned region: 234..254
AAA_19 [PF13245], Evalue: 0.00033, Aligned region: 623..647
IstB_IS21 [PF01695], Evalue: 0.00053, Aligned region: 217..253
IstB_IS21 [PF01695], Evalue: 0.00053, Aligned region: 625..653
NACHT [PF05729], Evalue: 0.00062, Aligned region: 234..334
NACHT [PF05729], Evalue: 0.00062, Aligned region: 626..652
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 234..252
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 625..660
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 813..835
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 623..650
Torsin [PF06309], Evalue: 0.0021, Aligned region: 583..649
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 234..245
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 623..643
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 709..727
Protein Sequence: 891 a.a.     [Download]
>gi|501683458|ref|YP_008003284.1| protein ClpV [Pseudomonas protegens CHA0]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLTDSDLHRIIRQFNLEPARLAKD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVIGILKTPSLRHALLGLSREFDK
IKVETLCERFDEYIGDSPENALSASDGFSAGAVPGEASGAMAPSALGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVVGDVPPALKDVELRSLDVGLLQAGA
SMKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEQHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREQAIGVAIGNRQVNSENLLTAERERLAE
LESRWAQEKTLVDELLATRAQLRENVGLVDSDVGDDSHGLREKLVDLQQRLSTLQGETPLILPTVDYQAV
ASVVADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPNKPIGVFMLAGT
SGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRKPYSVVLL
DEVEKAHPDVHEIFFQVFDKGVMEDGEGRMIDFKNTLILLTTNAGTELIANVCKNPQAVPEPEEIAKALR
QPLLEIFPPALLGRLVTIPYYPLSDEMLKAITRLQLGRIKKRVESTHKVDFDFDDEVIDLIVSRCTETES
GGRMIDAILTNSLLPDMSREFLNRMLEGRALAGVRISQRDNELHYDFSEPA
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6713888-6716563 Pseudomonas protegens CHA0, complete genome
ATGGGTGAAATCAGTCGCGCGGCGCTGTTCGGCAAACTCAACAGCGTTGCCTACAAAGCCATCGAAGCCG
CCACGGTCTTCTGCAAATTGCGGGGCAACCCCTATGTGGAACTGGCCCACTGGTTTCACCAGTTGCTGCA
ACTTACGGACTCGGACCTGCACCGCATCATCCGCCAGTTCAACCTGGAGCCGGCGCGCCTGGCCAAGGAC
CTGACCGAGGCCCTGGACCGCCTGCCCCGGGGCTCGACCTCGATCACCGACCTGTCGTCCCACGTCGAGG
AGGCGGTGGAGCGCGGTTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAGGTGCGCACCGGCTACCT
GGTGATCGGCATCCTCAAGACCCCGAGCCTGCGCCATGCGTTGCTGGGGCTGTCCCGCGAGTTCGACAAG
ATCAAGGTCGAGACCCTGTGCGAGCGCTTTGACGAATACATCGGCGACTCGCCGGAAAACGCCCTGAGCG
CCAGCGACGGCTTCAGTGCCGGTGCGGTGCCCGGCGAAGCCAGCGGCGCCATGGCCCCCAGCGCCCTGGG
CAAGCAGGAAGCCCTCAAGCGCTTCACCGTCGACCTCACCGAACAGGCCCGCAGCGGCAAGCTCGACCCC
ATTGTCGGCCGTGACGAAGAGATCCGCCAACTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTCACCGGTGAAGCCGGGGTGGGCAAGACCGCGGTGGTGGAAGGTTTCGCCCTGCGCATCGTCGTCGG
CGACGTGCCGCCGGCGCTCAAGGACGTTGAACTGCGCAGCCTCGACGTCGGCCTGCTGCAGGCCGGCGCC
AGCATGAAGGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATCGAGGACGTCCAGGCCTCGCCCAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTGGGCGCCGGTGGCGCCGCCGGCACCGGCGACGCGGC
CAACCTGCTCAAGCCGGCTCTGGCCCGTGGCACCCTGCGCACCGTGGCCGCCACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAAGACCCGGCCCTGACCCGGCGCTTCCAGGTGGTGCAAGTAGCCGAACCTTCGG
AAGACAAGGCGCTGCTGATGATGCGCGGCGTGGCCTCGACCATGGAACAGCACCATCAGGTGCAGATCCT
CGACGAAGCCCTGGAGGCCTCGGTCAAACTGTCCCATCGCTACATTCCCGCGCGCCAGTTGCCGGATAAA
TCCGTCAGCCTGCTGGATACCGCTTGCGCCCGCGTCGCCATCAGCCTGCACGCCGTGCCGGCCGAGGTGG
ACGATAGCCGCCGGCGCATCGAGGCCCTGGAAACCGAGCTGCAGATCATCGCCCGGGAACAGGCGATCGG
CGTTGCCATTGGCAACCGCCAGGTCAACAGCGAGAACCTCCTGACTGCCGAGCGCGAGCGCCTGGCCGAG
CTGGAAAGTCGCTGGGCACAAGAGAAGACCCTGGTGGACGAACTGCTGGCAACCCGCGCCCAATTGCGGG
AAAACGTCGGCCTGGTGGACAGCGACGTCGGCGACGACAGCCACGGCCTGCGGGAAAAACTGGTGGACCT
GCAACAGCGCCTCAGCACCCTGCAAGGCGAGACCCCGCTGATCCTGCCGACCGTGGACTACCAGGCCGTG
GCCTCGGTGGTCGCCGACTGGACCGGCATTCCAGTGGGGCGCATGGCCCGCAACGAGCTGGAAACCGTGC
TCAACCTGGACCAGCACCTGAAGAAACGCATCATCGGCCAGGACCACGCCCTGCAGATGATCGCCAAGCG
CATCCAGACCTCCCGCGCAGGCCTCGACAACCCGAACAAGCCGATTGGCGTGTTCATGCTGGCCGGCACT
TCCGGGGTGGGCAAGACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTATGGCGGTGAGCAGAACGTCA
TCACCATCAACATGAGCGAGTTCCAGGAAGCCCACACCGTGTCCACCCTCAAGGGCGCCCCGCCGGGCTA
TGTCGGCTACGGCGAAGGTGGCGTGCTCACCGAAGCGGTACGGCGCAAGCCCTACAGCGTGGTGCTGCTG
GACGAAGTGGAAAAGGCCCACCCGGACGTGCACGAGATCTTCTTCCAGGTATTCGACAAGGGCGTCATGG
AAGACGGCGAAGGCCGCATGATCGACTTCAAGAACACCCTGATCCTGCTCACCACCAACGCCGGCACCGA
GCTGATCGCCAACGTCTGCAAGAACCCGCAGGCGGTGCCCGAGCCGGAGGAAATCGCCAAGGCCCTGCGC
CAGCCACTGCTGGAGATCTTCCCGCCGGCACTGCTGGGGCGCCTGGTGACCATTCCCTACTACCCGCTGA
GCGACGAGATGCTCAAGGCCATCACCCGCCTGCAACTGGGGCGGATCAAGAAGCGCGTGGAAAGCACCCA
CAAGGTGGATTTCGATTTCGACGACGAGGTCATCGACCTGATCGTCTCGCGCTGCACCGAGACCGAAAGC
GGCGGGCGGATGATCGACGCCATCCTGACCAACAGCCTGCTGCCGGACATGAGCCGCGAGTTCCTCAACC
GCATGCTCGAAGGCCGCGCCCTGGCCGGGGTGCGCATCAGCCAGCGCGACAACGAACTGCACTACGACTT
CAGCGAGCCGGCCTGA
 Primer design