SecReT6
Protein ID: 501683461
SecReT6 ID764
T6SS typei3
Gene symbolrhsB
Locus tagPFLCHA0_c60550
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6719085..6723545 [+]
Productprotein RhsB
NotePAAR
UniProt IDR4RTV0
KEGG IDpprc:PFLCHA0_c60550
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 433..455
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 499..535
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 554..577
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 588..623
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 614..644
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 660..685
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 673..709
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 715..742
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 736..772
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 780..810
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 799..835
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 841..871
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 900..935
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 944..978
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1021..1033
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1045..1065
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1056..1092
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1080..1109
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1131..1142
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1134..1167
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1155..1186
RHS_repeat [PF05593], Evalue: 2.10E-66, Aligned region: 1191..1239
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 657..683
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 819..831
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 963..972
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 1015..1032
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 1133..1143
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 1188..1201
RHS [PF03527], Evalue: 5.20E-21, Aligned region: 1244..1282
PAAR_motif [PF05488], Evalue: 1.10E-09, Aligned region: 97..226
PAAR_motif [PF05488], Evalue: 1.10E-09, Aligned region: 227..290
DUF4595 [PF15283], Evalue: 0.00041, Aligned region: 479..515
DUF4595 [PF15283], Evalue: 0.00041, Aligned region: 601..630
DUF4595 [PF15283], Evalue: 0.00041, Aligned region: 788..857
DUF4595 [PF15283], Evalue: 0.00041, Aligned region: 929..958
DUF4595 [PF15283], Evalue: 0.00041, Aligned region: 1151..1181
Protein Sequence: 1486 a.a.     [Download]
>gi|501683461|ref|YP_008003287.1| protein RhsB [Pseudomonas protegens CHA0]
MSDALWAARLGDGLEHTSMMADILGGVLEVAANVAIGALATMAVAAAAGITVATGGLGACVLGLVVGVVV
GVVMSKTGADKGLSNLCEGIANALFPPSIQATIASGSKKVLTNNKPAARAAGIAPPTQISGDGAEEGEAT
DTPSATPEEGPGFLDMAKEFFSQMWRPTVASPAPGSQTKELDLVTCTKHPPMPVQYLAEGSEKVSIDGQP
AVRSGDRSTCDAKVVSAGPISPNVTIGGGSVVVREIRSGKTPGVGLAVTVLMMLKGGKGKFLSNLPCMLM
AGVNSFVVSQATNALTQAVVASTHPVHAATGAKVLGADDDLDFTLPGLMPIEWQRFYNSRDERRDGLLGA
GWSLPYEISVQIEPHPEGGERLLYIDEQGRRIDMGSIALGAGAFSPGEGLSVRRNENGQLLIESSDGIYR
LFEPLPGDSSRLRLSQLGDRNDNRLHLEYDSSGRLWLLRDTFEQAQLELSYSTLWPGRIAQVERLYPDQQ
REVLVSYDYDAAGDLAQVRDSEGQVQRRFAYDAGHRMTEHQLATGLRCFYQWTQFADQQWRVTRHWTDEG
DSYQYDYDLEAGITQVTDSLQRLSRRRWNSQLQIVEYTDNLNQTWAFEWNDERQLLSATDPLGGRYAYSY
DETGNLIAETDPLGHSHSTLWLEHWSLPQTLTDPAGESWHLRYDPRGNCIAEVDPLGQVTQYRHDAHGQV
VEIIDAAGRSRKMRWNSSGQLLEHLDCSGYPTRFEYDRRGNVKAIIDAHGEHTRFHYDCQGRLLSSQLAD
GRAEHFQRSSNGQLQGYTDPSGYTTLYQYNRRGQIRQRIDAHGRQVRFDYDAYGRLLALTNENGESYRFA
WDAGNRLSEQQDLDGSAKRYGYDLLNNVVELQSHPAPYGTGLSAVPAQPIAPIIHRFERDAVGRLLAKIT
DDGRSQYTYDPLNQLTAASFTDNLGNQQALSFSYDALGQLLEEHTVAGSLIHRYDELGNLTQTQLPDKRW
LNRLYYGSGHLHQINLDGQVVSDFQRDRLHREVLRTQGQISTRSEYDRCGRLRARLQHSSLLANTLPTAP
ERHLEYDDSDNLVGLAERHATGQHRQLFHYDATGRIIASQDGLQGQKETFAYDAAANLLDGPKAGAGLVV
HNKLLTYQDKRYRYDAFGRMIEKRSGRRGVQRFAYDAEHRLIEVRNQTSSGETLVRMRYDVLGRRISKSE
YDSQGNLLGETRFVWDGLRLLQEQRNQQTSLYVYEDLGHAPLARVDGLGAQQKIRYYHNDLNGLPQQLCE
PDGHSVWQARYQVWGNTVEEIREPYYIEEQNLRFQGQYLDRETGLHFNTFRFYDPDIGRFTTPDPIGLAG
GLNLYQYAPNPIGWIDPLGWICKSAYSGRRGTTKAKADLERNGFTVVGEELTMKVKHPVTQKSYRIRADI
IAKDKAGNYHVFEVKNGSGKLTKNQQGSGMFDMSNPANTNGGLGGGLIKPSGATQGQFEVATKTARGTQF
GGNGAQHSATFWLLRY
 
Nucleotide Sequence: 4461 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6719085-6723545 Pseudomonas protegens CHA0, complete genome
ATGTCTGACGCACTGTGGGCCGCCCGCCTGGGCGACGGGCTGGAACACACCTCGATGATGGCCGACATTC
TCGGCGGCGTGCTGGAGGTGGCGGCCAACGTTGCCATCGGCGCCCTGGCGACCATGGCAGTAGCCGCGGC
GGCAGGCATCACCGTGGCCACCGGCGGCCTCGGCGCCTGTGTGCTGGGGCTGGTGGTGGGCGTCGTCGTC
GGCGTGGTCATGAGCAAGACCGGAGCCGACAAGGGCCTGAGCAATTTATGCGAGGGCATCGCCAACGCCC
TGTTCCCGCCCTCGATCCAGGCCACCATCGCCAGCGGCTCGAAAAAGGTCCTGACCAACAACAAGCCGGC
GGCCCGCGCGGCCGGCATCGCACCGCCGACACAGATCAGCGGCGACGGCGCCGAAGAAGGCGAGGCCACC
GACACCCCGTCGGCAACGCCCGAGGAAGGGCCCGGTTTCCTCGACATGGCCAAGGAGTTTTTCTCACAGA
TGTGGCGGCCCACCGTGGCCTCCCCGGCGCCAGGCTCCCAGACCAAGGAACTGGACCTGGTGACCTGCAC
CAAGCACCCGCCGATGCCGGTGCAGTATCTGGCTGAAGGCTCGGAAAAGGTCAGCATCGACGGCCAGCCG
GCAGTACGCAGCGGCGACCGCAGCACCTGCGATGCCAAGGTAGTGTCGGCCGGGCCTATCTCCCCGAACG
TGACCATCGGCGGTGGCTCGGTGGTGGTGCGCGAGATCCGTAGCGGCAAGACCCCGGGGGTGGGCCTGGC
GGTGACCGTGCTGATGATGCTCAAGGGCGGCAAGGGCAAGTTCCTCAGCAACCTGCCGTGCATGCTGATG
GCCGGGGTCAATTCCTTTGTCGTCAGCCAGGCCACCAATGCTTTGACCCAGGCCGTCGTCGCCTCGACCC
ACCCGGTGCATGCAGCCACCGGGGCCAAGGTGCTCGGAGCCGACGACGATCTGGATTTCACCCTGCCCGG
GCTGATGCCCATCGAATGGCAACGCTTCTACAACAGCCGCGACGAACGTCGTGACGGCCTGCTCGGGGCC
GGCTGGAGCTTGCCTTACGAGATCAGCGTCCAGATCGAGCCCCACCCCGAAGGGGGCGAGCGCCTGCTCT
ACATTGATGAGCAAGGACGCCGCATCGACATGGGCTCCATTGCCCTGGGTGCAGGAGCCTTCAGCCCCGG
TGAAGGCTTGAGCGTGCGACGCAACGAGAACGGACAGTTGCTGATCGAAAGCAGCGACGGTATCTACCGT
CTGTTCGAGCCGCTGCCGGGCGACTCCTCGCGGCTGCGCCTGAGCCAGCTGGGGGACCGCAACGACAACC
GTCTGCACCTGGAGTACGACTCGTCCGGACGCCTCTGGCTGCTGCGTGACACCTTTGAACAGGCGCAGCT
CGAACTGAGCTACAGCACGCTCTGGCCCGGTCGGATTGCCCAGGTCGAACGGCTGTACCCCGACCAGCAA
CGGGAAGTGCTGGTCAGCTACGACTACGATGCGGCAGGAGACCTGGCACAGGTGCGCGATAGCGAAGGCC
AGGTACAGCGTCGCTTCGCTTATGACGCCGGCCACCGGATGACCGAACATCAATTGGCCACCGGGCTGCG
CTGCTTCTATCAATGGACACAATTTGCCGACCAGCAGTGGCGAGTGACCCGTCACTGGACCGACGAAGGC
GATAGCTATCAGTACGACTATGATCTGGAGGCGGGAATCACCCAGGTCACCGACAGCCTGCAACGCCTCA
GCCGCCGCCGCTGGAACAGCCAGTTGCAGATCGTCGAGTACACCGACAACCTCAACCAGACATGGGCCTT
CGAGTGGAACGATGAGCGCCAACTGCTCAGCGCCACCGACCCCTTGGGAGGGCGCTATGCCTATAGCTAC
GACGAAACCGGCAACCTGATAGCCGAGACCGATCCTCTGGGGCACAGCCATTCGACCTTGTGGCTGGAGC
ACTGGTCGCTGCCACAGACCCTGACCGATCCCGCCGGAGAAAGCTGGCACCTGCGCTACGATCCCCGGGG
CAACTGTATCGCCGAAGTAGACCCGCTGGGCCAGGTGACCCAGTACCGCCATGACGCGCACGGCCAGGTG
GTGGAGATCATCGATGCCGCGGGAAGAAGCCGGAAGATGCGCTGGAACTCGTCCGGGCAACTGCTTGAAC
ACCTGGACTGCTCGGGCTATCCAACCCGCTTCGAATACGATCGACGCGGCAACGTGAAAGCCATCATCGA
TGCCCATGGCGAGCACACCCGGTTCCATTACGACTGCCAGGGACGGTTGCTGAGCAGTCAACTGGCCGAT
GGGCGCGCCGAGCATTTTCAACGCAGCAGCAACGGTCAGCTACAGGGCTACACCGACCCTTCCGGCTACA
CCACGCTCTACCAGTACAACCGGCGCGGGCAGATACGCCAGCGCATCGACGCTCACGGCCGACAGGTCCG
GTTCGACTATGACGCGTACGGACGGCTGCTGGCGCTCACCAACGAGAACGGCGAAAGCTATCGCTTTGCC
TGGGACGCCGGCAACCGCTTGAGCGAACAGCAGGACCTCGACGGCAGTGCCAAACGCTATGGCTATGACC
TGCTGAACAACGTCGTCGAACTCCAGTCCCACCCCGCCCCTTATGGCACCGGGCTGAGCGCCGTGCCCGC
GCAACCTATCGCGCCGATCATCCACCGGTTCGAGCGCGATGCCGTGGGGCGGCTGCTGGCCAAAATCACA
GACGATGGCCGCAGCCAATACACCTACGACCCCTTGAACCAACTGACCGCCGCCAGCTTTACCGACAACC
TCGGCAACCAGCAGGCACTGAGTTTCAGCTACGACGCCCTGGGCCAATTACTCGAAGAACACACCGTGGC
CGGCAGCCTGATCCATCGATACGACGAACTGGGCAATTTGACTCAGACCCAGCTACCGGACAAGCGTTGG
CTCAACCGGCTCTATTACGGCAGCGGCCATCTGCACCAGATCAATCTCGATGGCCAGGTAGTCAGCGACT
TTCAACGTGACCGCCTGCACCGTGAGGTGCTGCGCACCCAGGGTCAGATCAGCACTCGCAGCGAATACGA
CCGGTGTGGCCGCCTGCGCGCACGCCTGCAGCATTCCAGCCTGCTGGCAAACACCTTGCCAACAGCCCCG
GAGCGACACCTGGAGTACGACGATAGCGATAATCTGGTGGGCCTGGCCGAGCGACATGCCACCGGGCAAC
ATCGGCAACTGTTCCATTACGACGCGACCGGGCGAATCATTGCCAGCCAGGACGGCCTGCAGGGCCAGAA
AGAAACCTTCGCCTATGACGCCGCCGCCAATTTGCTTGATGGCCCGAAGGCGGGCGCCGGGCTGGTGGTG
CACAACAAATTGCTGACCTACCAGGACAAGCGCTACCGCTACGATGCCTTCGGGCGAATGATTGAAAAAC
GCAGTGGTCGGCGAGGCGTGCAACGTTTTGCCTACGACGCCGAACACCGGTTGATCGAAGTGCGCAATCA
GACCTCCAGCGGCGAAACCCTGGTCAGGATGCGCTACGACGTCTTGGGTCGCCGCATCAGCAAGAGCGAG
TACGACAGCCAGGGCAACCTTCTGGGTGAAACGCGATTCGTCTGGGATGGCCTGCGGCTGCTGCAGGAAC
AGCGTAATCAACAGACCAGCCTCTATGTCTATGAAGACCTGGGACATGCGCCCCTGGCGCGGGTCGACGG
CCTCGGCGCGCAGCAGAAGATCCGCTACTACCACAACGACCTGAATGGCCTGCCTCAACAGCTTTGCGAG
CCTGACGGCCATAGCGTCTGGCAGGCCCGCTATCAGGTCTGGGGCAACACTGTCGAAGAAATACGCGAGC
CCTACTACATCGAGGAACAGAATCTCAGGTTCCAGGGCCAGTACCTGGACCGCGAGACTGGATTGCACTT
CAACACGTTCCGTTTCTACGACCCGGATATCGGGCGCTTCACCACGCCGGACCCCATCGGCCTGGCCGGA
GGCTTGAACCTTTATCAGTACGCTCCCAACCCAATCGGTTGGATCGATCCGCTGGGCTGGATCTGCAAAT
CGGCCTACAGCGGCAGAAGGGGCACTACAAAAGCCAAAGCGGACCTCGAGAGGAACGGTTTCACTGTGGT
AGGTGAAGAATTGACCATGAAGGTCAAACACCCTGTCACCCAGAAGTCCTATCGCATCAGGGCAGATATC
ATCGCCAAGGACAAAGCCGGTAACTACCACGTGTTCGAAGTCAAAAATGGCAGCGGCAAACTGACCAAGA
ACCAACAGGGATCGGGAATGTTCGACATGAGCAATCCGGCCAATACGAACGGTGGTCTGGGCGGTGGCCT
GATCAAACCGTCGGGCGCTACCCAGGGCCAGTTCGAAGTTGCGACCAAAACCGCCAGAGGTACCCAGTTC
GGTGGCAATGGCGCACAGCATTCGGCCACCTTCTGGCTTCTTCGCTATTGA
 Primer design