SecReT6
Protein ID: 507480531
SecReT6 ID792
T6SS typei4b
Gene symboltssM
Locus tagtssM
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]10082..13840 [+]
Producthypothetical protein
NoteTssM
UniProt IDR9RIP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.80E-71, Aligned region: 161..423
IcmF-related [PF06761], Evalue: 3.50E-53, Aligned region: 435..469
IcmF-related [PF06761], Evalue: 3.50E-53, Aligned region: 469..810
DUF1215 [PF06744], Evalue: 9.30E-25, Aligned region: 747..770
DUF1215 [PF06744], Evalue: 9.30E-25, Aligned region: 834..863
DUF1215 [PF06744], Evalue: 9.30E-25, Aligned region: 941..1053
Protein Sequence: 1252 a.a.     [Download]
>gi|507480531|ref|AGM48625.1| hypothetical protein [Acinetobacter baumannii]
MSSYTSIPRHIFWALASAYALGLIVYGIYWLIQRKKHAVQGEELAEAIEKDTQAEYGKNKDKEELQLISQ
QMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNC
DWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPVNGLILIVSIAELVSQSPEHSLKLAKNL
RARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEVQEYNQAWGATLPYEQNSSHNAVDLFEKHYTI
LYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKTFIATLFEDNPYQFQPVFRGFYFTSALQEG
VIESPMTEQIAQEFQLSQIAQNEVRDQLKTTPNHGYFLKGLFSEVILKDKDLVKQHVNTSRKRQRYIAFI
GALAGVSIILGVWVWSYRNNQQLISEVQADLNKVVQLEKGSSQQLSTQLEALLILQRRLQQLDEFDENRP
LKFSFGLYQGNELREKLKAEYLKGVKQIVLTPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYL
EPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLA
NDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRAAVRFPALTVSQIVGEANKNVVLGSYAL
PGVFTQKAWNDYVEKAIEEAADKPTDSKDWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLS
GIHYAKANQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDNPVVQAELAAPQKGFIAWFKRKVLNRDD
KQLANQAVANAQGAISQEYQMFYQLVRKRDDQQGKSLLDEYMTNLALVRSKFNELKNAGEVGPSAMTLVK
QTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTT
NLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQFVMNF
QRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQG
SIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRLISSNSG
SIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPVKPANPVAALTQPAATQPAAGVKP
 
Nucleotide Sequence: 3759 bp     [Download]
>gi|507480521|gb|KC432605|tssM|:10082-13840
ATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATCTGCATATGCTTTAGGGCTCA
TTGTTTATGGAATTTATTGGCTAATTCAGCGCAAGAAGCATGCGGTTCAAGGTGAAGAGCTTGCTGAAGC
AATTGAAAAAGATACTCAAGCAGAGTACGGAAAAAATAAAGATAAAGAAGAACTACAACTTATCAGCCAG
CAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGTTAGGCGATAAGAAGGGTAATGCAGCACTAT
ATGAATTGCCGTGGTATATGGTTATTGGTAACCCAGCCGCTGGTAAAAGTTCTGCGATCTATAATTCTGG
TTTAAAGTTCCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGTGGTACCCGTAATTGT
GACTGGTTCTTTTCTACAGAGGGTATTTTATTAGATACGGCTGGTCGTTATTCGGTATATAGTGAAGATC
ATTCAGAGTGGTTAGGTTTTTTAAATATATTAAAGAAGAACCGTTCTAAAGCTCCGGTAAATGGCTTAAT
TCTTATTGTAAGTATTGCTGAGCTGGTGAGCCAAAGCCCTGAACACTCATTGAAACTTGCTAAAAATTTA
CGTGCTCGTATTCAAGATTTAACTGAGCGTTTAGAAGTTGTAGTGCCTGTTTATTTAGTCTTTTCAAAAA
TGGATTTGATTGCGGGTTTTACCGAATTTTTCGAATTCTATGAAGTCCAAGAATATAATCAGGCATGGGG
TGCCACACTACCATATGAGCAAAACTCTTCTCATAATGCGGTAGATCTTTTTGAGAAACATTACACTATT
CTTTACGATGGTTTAAAAGGGGTGAGCTCGACTCATCTTAGCCGTCGACACTCTCAAAATATCTCACCGA
GTGTGATGACTTTCCCATTAGAATTTAAAACATTAAAGCCTGCGTTAAAAACCTTTATTGCAACACTGTT
TGAAGATAACCCTTACCAGTTCCAGCCAGTTTTCCGTGGTTTCTATTTCACAAGTGCCTTGCAAGAAGGT
GTGATCGAAAGTCCAATGACTGAGCAAATTGCACAAGAATTTCAGCTTTCTCAAATTGCTCAAAATGAAG
TAAGAGATCAATTAAAAACAACACCTAACCATGGTTATTTCTTAAAAGGCTTATTTTCCGAAGTCATTTT
AAAAGATAAAGATTTAGTTAAACAGCATGTTAATACAAGCAGAAAACGTCAACGCTACATTGCATTTATC
GGTGCTTTAGCGGGTGTTTCAATTATTCTGGGTGTATGGGTTTGGTCGTATCGCAATAACCAACAGCTTA
TTTCTGAAGTTCAAGCTGATTTAAATAAAGTCGTTCAGTTAGAGAAGGGTTCAAGTCAGCAGTTGTCGAC
TCAATTGGAAGCCCTACTTATTTTACAAAGACGTCTACAACAATTAGACGAGTTTGATGAAAACAGACCT
CTAAAATTTAGCTTTGGTTTATATCAAGGCAATGAGTTACGTGAAAAATTAAAAGCTGAATATTTAAAAG
GCGTTAAACAAATTGTTTTAACACCTACTCAGCAAAATATTGCTCAATATTTGCAACGTGTAAAAAATAA
CGAAGCGACTTTAAAAGCTAATCATACCAATGTAGAGATTAAGCAAACTGCTCAAACTCAGCAATATCTA
GAGCCTTCAGATACCAATCCTCAAGATGCTTATAATGCATTAAAAGCATATTTGATGATGAGTAATCCAC
AGTATATGGATGCAAGTCATTTAAGTGATCAAGTAACGCGTTTCTGGCGTTCTTGGCTTGATGCCAATAA
AGGGCAGATGCCACGTGCAGATATGATTCAGGAAGCTGAACAGATCTTATCGTATGCAATGACATTAGCA
AATGACAAGCAATTCCCGATTTTGGATGCTGACTCTCAATTAGTTGATCAGACACGTCAAGTATTGCTCT
CTGTGATTAGAGGTATGCCAGCACGTGACCGTGTTTATAACGAAATTAAAATGCGTGCTGCTGTTCGCTT
CCCAGCTTTGACAGTAAGTCAAATTGTTGGTGAGGCAAATAAAAATGTTGTGTTAGGCAGCTATGCATTA
CCAGGTGTATTTACTCAAAAAGCTTGGAATGACTACGTAGAAAAAGCCATTGAGGAAGCAGCAGATAAGC
CTACAGATAGTAAAGACTGGGTGCTTAATAGTCGTCAATCTGATGACTTAACTTTCTCGGGTAGCCCAGA
GCAAATTAGAAAGCAGCTCACAGCACTTTATAAGCAAGAATATATTGCGGAATGGAGAAAATTCTTAAGT
GGTATTCACTATGCAAAAGCAAATCAATTTGCTCAGCAAGTCAAAAATATTGATGTATTAGGTGAGCCAC
AAAATTCACCAATTCGCACGCTTATTGAACGTGTAGCAATTGAAACAAATTGGGATAATCCAGTTGTTCA
AGCAGAATTAGCTGCTCCTCAAAAAGGATTTATTGCATGGTTCAAACGCAAAGTCTTAAACCGTGATGAT
AAACAATTAGCAAATCAAGCAGTTGCTAATGCTCAAGGTGCTATTTCTCAAGAATATCAAATGTTTTATC
AGTTGGTTCGTAAACGTGATGATCAACAGGGTAAATCTTTACTTGATGAATATATGACAAATCTTGCTTT
AGTGCGTAGTAAGTTTAATGAACTTAAAAATGCGGGTGAGGTTGGGCCAAGTGCTATGACATTAGTTAAG
CAAACCTTAAATGAGCAGACATCGGTATTTAATCAGACTCAAAAAATTGTAGATGAAAAAATGGCGGTTG
GTTTCAGTGAAATTGATCAGCAATTGCTACAAAAATTAGTGGTAAGTCCTCTTACACAAGCTTTTGAAAG
TCTAATTACACCGACTCAAGATGAAATTAATAAACTTTGGGTTATGCAAGCGTATCAGCCATTTACAACA
AATCTTGCTAAGAAATATCCGTTTAACTCATCCGCTTCTTTACAAGCAACAAGTAGTGAAATTGGTCAAA
TTCTTGGTGAAAACGGTAGCATTTCCCGTTTTGTTAAAGAGAGCTTAGACCCATTTGTTATTCGTCGTGG
CTATACCTTAACTTCAAAAACATGGAAAGATTTGGGTATTAGTTTAAACCCGCAATTTGTAATGAATTTC
CAACGCTATGTTGCACCTACAAATGGTATGGCAACTGGGGAGTTAAATAGTCAAGCACCAGCGGCTCCGG
CAACAAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAATTGCTTTCATATACCGTTGATAT
TGATGGTCAGCGTATGACTTATGAAAATGGTGTACAGCAATGGGTTAACTTTATTTGGCCAAATCAAGGC
AGTATTCCTGGTGCACGTATTACGGCTGTAGATTTACAAGGTCAAACGCATACGATTTTTGATGAACCAG
GTGAATATGGCATTAACCGCTTAATTGATAGTGCACAGCGTAAAGAGCAGAACGGTGGTTTCGAAATGCT
TTGGCGCAGTAAGACGGATCCATCATTGTTTGTGAAAATGAACTTCCGTCTTATTAGTAGTAACTCAGGC
AGTATTGGTTCAAGTCGCGGTTACTCTGGTATGCAATTGGTTGACAAAGTTACTGCTGATAAAGCTGCCC
GTGTTGTATCGGCGCAGCAAGCACCAGCTCAGGCAGCTGCTCCTGTGAAACCTGCAAATCCAGTTGCTGC
ATTAACACAACCTGCTGCAACTCAACCAGCTGCAGGAGTTAAGCCATGA
 Primer design