SecReT6
Protein ID: 507517899
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04580
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]461407..465282 [-]
Productlipoprotein putative
NoteTssM
UniProt IDR4X264
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.50E-52, Aligned region: 175..427
ImcF-related_N [PF14331], Evalue: 4.50E-52, Aligned region: 505..548
ImcF-related_N [PF14331], Evalue: 4.50E-52, Aligned region: 1028..1057
ImcF-related_N [PF14331], Evalue: 4.50E-52, Aligned region: 1200..1235
DUF1215 [PF06744], Evalue: 0.0012, Aligned region: 510..519
DUF1215 [PF06744], Evalue: 0.0012, Aligned region: 943..1006
Protein Sequence: 1291 a.a.     [Download]
>gi|507517899|ref|YP_008039515.1| lipoprotein putative [Burkholderia sp. RPE64]
MKTLGIALLWLLTLVVTALISWGVVLYFGWPLWVALALLAGVFALFFFGLFARRMFVMMRSRSRLARQTR
ALRIDVPAESPETLLRRKWKTAIATLRQSNLRSQGDPLYALPWFMVVGQSGTGKTTALTRARLSSPIQKI
SQQAGIGQTANCDWWYFDRAVVIDCAGRYVQSEDIEQDRREWELGLDLLGRYRPREGLDGLVLAVSADRL
MAPDADTFADEGRIVRARIEQLIRMFGKRFPVYVLVTKCDRLYGFEEWAKTLPADALGQAMGYLAEESET
SQSGESAFVARAFDSIGARLQALRLALVSREAQPSAELLMFPNELAQLRGGLTMFLGSCLADSPYLERPL
LRGIFFSSGQQEGGAMSALMGSLLPASPPHASNTAGVFLHDFFGRILPQDRHAAKSTVLVHHWRRVTQSV
GIVAWVLLLAMLGILLSVSFAGNKQTLDMVRSARPDQVALNGNLFHDAAALTYSNDVLMQVAQNDRRWMS
GLLGNGAGLAALEARLHEVFVQQFRQAIQPAADQTQQMALISAAQTGQSVEQARQLLNLARSISLLQARL
DGAGRATLDAMPQPVATPLYPAQLSAQLNPLTISYLVWSPADAAYLRDRLKDQRALLDQAVAADPQLTWL
VGLVPDDGSLAPVRVADFWGGSVQTDINARTAKGSVTGAGASGATVAAAYTVAGRQALDGLAKQIRDSVS
DPAQFDKQRVAFDGWYRTQRVAAWQNFVEGFTSSPVPYSGEAGWRSALGIVSGPASPYFRLIARLGEEFE
GERADAPLPGWLVLARQFQQVREQATRMGAANQAVKMAGAINAVGASAIKDVLAGAPQRGTQTVANNLGA
VDATTQYLAALNQLAIDSGTGSGKAYQLAADYQQFAASAQSQPSEMMNALQPLTQLRALIGTGDGSDALT
WRLIRGPFDFIAAYVEQQASCELQRGWESGVVFPLQGATDKSAAIDQLFGAKGAVWAFADGAAKPFLVRN
ASRYAIVDTQGFSVPFTSSFVPMLNGAYGRQLAQAQSVARSAADKQAQQLQAQRAQLDAQQQLDQLDRAL
AAAKTQADAARALSVPLTLTAQPTNVNADAQAKPYATILTVQCAAGVQTLNNYNFPVSTSFAWTAGQCGD
VRLQIKIGNLTLTRSYAGPLGVAGFLKDFADGQRQFGPADFPASETALRTLNVQSLTVSFTVTGGEQVID
AARKIDQYDALQKTTAQQKQQIQDAQAQRQQMSIADQLAAVNPPLPGVPPLPTIPALAGVPSIMPAVASN
PNPLSLTELGLPATIGMCWRGQTSPMLMTGL
 
Nucleotide Sequence: 3876 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c465282-461407 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGAAAACGCTGGGCATCGCATTGCTGTGGCTGTTGACGCTGGTCGTGACGGCACTGATCAGCTGGGGCG
TCGTGCTGTATTTCGGCTGGCCCCTGTGGGTCGCGCTGGCGCTGCTTGCCGGCGTGTTCGCGCTGTTCTT
CTTTGGCCTGTTCGCGCGCCGCATGTTCGTGATGATGCGCTCGCGCAGCCGCCTCGCGCGGCAGACCCGC
GCGCTGCGCATCGACGTGCCGGCCGAGTCGCCGGAAACGCTGTTGCGGCGCAAGTGGAAGACGGCGATCG
CCACGCTGCGCCAGTCGAATCTGCGCAGCCAGGGCGATCCGCTCTATGCGTTGCCGTGGTTCATGGTGGT
CGGGCAGTCGGGCACCGGCAAGACCACGGCGCTCACGCGCGCACGGCTTTCGTCGCCGATTCAGAAGATC
AGCCAGCAGGCCGGCATCGGCCAGACGGCCAACTGCGACTGGTGGTATTTCGACCGCGCCGTGGTAATCG
ATTGCGCCGGGCGTTATGTGCAATCGGAAGATATCGAGCAGGACCGGCGCGAGTGGGAACTCGGGCTCGA
TCTCCTCGGGCGTTACCGGCCGCGCGAAGGTCTCGACGGCCTCGTGCTCGCGGTCAGCGCGGACCGGCTG
ATGGCGCCGGACGCGGATACCTTCGCCGATGAAGGACGCATCGTGCGGGCGCGCATCGAACAGTTGATCC
GCATGTTCGGCAAGCGCTTTCCGGTGTATGTGCTGGTCACCAAGTGCGACCGCCTGTACGGCTTCGAGGA
ATGGGCGAAGACGCTGCCCGCCGATGCGCTCGGCCAGGCCATGGGCTATCTCGCGGAAGAGAGCGAGACG
AGTCAGTCGGGCGAAAGCGCGTTCGTCGCGCGCGCGTTCGATTCGATCGGCGCGCGTTTGCAGGCGCTGC
GGCTGGCGCTGGTGTCGCGCGAGGCGCAGCCGTCGGCCGAACTGCTGATGTTCCCGAACGAACTGGCGCA
GTTGCGCGGCGGCCTGACGATGTTCCTCGGCAGTTGTCTCGCCGACAGCCCGTATCTCGAACGGCCGCTG
TTGCGCGGCATCTTCTTTTCCAGCGGCCAGCAGGAAGGCGGCGCGATGTCCGCGCTGATGGGCTCGCTGC
TGCCCGCCTCGCCGCCGCATGCGAGCAACACGGCGGGCGTGTTCTTGCACGACTTCTTCGGCCGCATCCT
GCCGCAAGACCGTCATGCCGCGAAGTCGACGGTGCTCGTGCATCACTGGCGGCGCGTCACGCAGAGCGTG
GGCATCGTCGCGTGGGTGTTGTTGCTGGCGATGCTCGGCATTCTGTTGTCGGTGTCCTTCGCGGGCAACA
AGCAGACGCTCGACATGGTGCGCAGCGCGCGGCCCGATCAGGTGGCGCTCAACGGCAACCTGTTCCACGA
TGCCGCCGCGCTCACGTATTCCAACGACGTGCTGATGCAGGTCGCGCAGAACGACCGGCGCTGGATGTCG
GGCTTGCTCGGCAACGGCGCGGGACTCGCCGCGCTCGAAGCCCGTCTGCATGAAGTGTTCGTGCAGCAAT
TCCGGCAAGCGATTCAACCGGCCGCCGACCAGACTCAGCAGATGGCGCTGATCTCGGCGGCGCAGACGGG
CCAATCTGTCGAACAGGCGCGGCAACTGTTGAATCTCGCGCGTTCGATCTCGCTCTTGCAGGCGCGCCTC
GACGGCGCCGGCCGCGCGACGCTCGACGCGATGCCGCAGCCCGTCGCCACGCCGCTCTATCCCGCGCAAC
TGAGCGCGCAACTCAACCCGCTCACGATTTCCTATCTCGTCTGGTCTCCGGCGGATGCGGCTTATCTGCG
CGACCGCCTGAAGGATCAGCGCGCGCTGCTCGATCAGGCCGTCGCCGCCGATCCGCAATTGACCTGGCTC
GTCGGACTCGTTCCGGACGACGGCTCGCTCGCGCCGGTACGCGTCGCGGATTTCTGGGGCGGCAGCGTGC
AGACCGACATCAACGCGCGCACGGCGAAAGGCAGCGTCACGGGCGCCGGCGCATCGGGCGCGACCGTGGC
CGCCGCCTATACCGTCGCGGGCCGTCAGGCGCTCGACGGTCTGGCCAAACAGATTCGCGATTCCGTCAGC
GATCCCGCTCAGTTCGACAAACAACGCGTCGCGTTCGACGGCTGGTATCGCACGCAGCGCGTGGCGGCGT
GGCAGAACTTCGTCGAAGGATTCACGAGCAGCCCGGTGCCGTATTCGGGCGAAGCGGGCTGGCGTTCGGC
GCTGGGCATCGTCAGCGGTCCGGCGAGTCCGTATTTCCGTCTGATCGCGCGGCTCGGCGAGGAGTTCGAA
GGCGAACGCGCCGATGCGCCGCTGCCCGGCTGGCTCGTGCTGGCGCGCCAGTTCCAGCAAGTGCGCGAGC
AGGCCACGCGCATGGGCGCGGCCAATCAGGCCGTGAAGATGGCGGGCGCGATCAACGCGGTCGGGGCATC
GGCGATCAAGGATGTGCTTGCGGGCGCGCCGCAGCGCGGCACCCAGACCGTGGCGAACAACCTCGGTGCC
GTCGATGCGACCACGCAGTATCTCGCCGCCCTCAACCAACTCGCGATCGACAGCGGCACGGGCAGCGGCA
AGGCTTATCAGCTCGCGGCGGACTATCAGCAGTTCGCGGCAAGCGCGCAGTCGCAGCCGTCCGAGATGAT
GAACGCGTTGCAGCCGCTCACGCAGTTGCGCGCGCTGATCGGCACCGGCGACGGCTCGGACGCGCTGACG
TGGCGTCTGATTCGCGGACCGTTCGATTTCATCGCGGCCTATGTCGAACAGCAGGCATCGTGCGAATTGC
AGCGCGGCTGGGAATCGGGCGTGGTGTTTCCGTTGCAGGGCGCGACCGACAAGAGCGCGGCCATCGATCA
GTTGTTCGGCGCGAAGGGCGCGGTGTGGGCCTTCGCGGACGGCGCGGCCAAGCCTTTCCTCGTGCGCAAC
GCGAGCCGTTATGCAATTGTCGATACACAAGGCTTCAGCGTGCCGTTCACGTCGTCGTTCGTGCCGATGC
TCAACGGCGCGTATGGACGTCAACTGGCGCAGGCGCAATCGGTCGCACGCAGCGCCGCCGACAAGCAGGC
GCAGCAGTTGCAGGCGCAGCGCGCCCAGCTCGATGCGCAGCAGCAGCTCGATCAGCTCGACCGCGCGCTC
GCGGCGGCCAAGACGCAGGCCGATGCCGCCCGCGCGCTGTCGGTGCCGCTCACGCTGACGGCCCAGCCCA
CCAACGTCAACGCCGACGCGCAGGCGAAACCCTACGCGACCATTCTCACGGTGCAGTGCGCGGCGGGCGT
GCAGACGCTCAACAACTACAACTTCCCGGTGAGCACCAGCTTCGCGTGGACGGCGGGACAATGCGGCGAT
GTGCGTCTGCAGATCAAGATCGGCAATCTGACCTTGACGCGCAGTTATGCGGGGCCGCTCGGCGTCGCGG
GCTTTTTGAAGGACTTCGCGGACGGCCAGCGCCAGTTCGGTCCCGCCGATTTTCCGGCGAGCGAAACGGC
GCTCAGAACGCTCAACGTGCAGTCGCTGACGGTGAGCTTCACGGTGACGGGCGGCGAGCAGGTGATCGAT
GCGGCGCGCAAGATCGATCAGTACGATGCGCTGCAAAAGACCACCGCGCAGCAGAAGCAGCAGATTCAGG
ACGCGCAGGCGCAGCGCCAGCAGATGAGCATCGCCGATCAGCTCGCGGCCGTGAATCCGCCGCTGCCGGG
CGTGCCGCCGCTGCCGACGATTCCGGCCCTGGCCGGCGTGCCGTCGATCATGCCGGCTGTCGCGAGCAAT
CCGAATCCGTTGAGCTTGACCGAGCTGGGATTGCCGGCGACCATCGGCATGTGCTGGCGCGGGCAGACTT
CGCCGATGCTGATGACCGGCCTTTGA
 Primer design