SecReT6
Protein ID: 510027003
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssM
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]897..4424 [-]
ProductTssM
NoteTssM
UniProt IDR9TIQ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.30E-42, Aligned region: 214..449
IcmF-related [PF06761], Evalue: 2.70E-30, Aligned region: 544..802
DUF1215 [PF06744], Evalue: 6.00E-23, Aligned region: 909..1030
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 105..182
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 832..869
MMR_HSR1 [PF01926], Evalue: 0.0034, Aligned region: 127..266
Protein Sequence: 1175 a.a.     [Download]
>gi|510027003|ref|AGN32395.1| TssM [Campylobacter jejuni]
MFKKIFDFVKSRLFITAFLLCCIFLLSILFWFWGSLVAFNDIYIFSSSFLRFSIILIIWLIVFLFFLLKP
IINFISSLKSEKRLKFKVLKKEADEFTYKSKRNFFLSLKDAKETWKNDLKTKNLPLIIIIGNEGAGKSTF
INYSDIEYPLSDSLESYKKFHKSTRNFALYVSKKGALLDTEGNYFSQEEFFKPTSSDEIPEDDIDKNRDF
LIKKNIWKKFLTFLNKNFFHSKLNGIILVVDTVIFLNNPKEYSKNLIRYLTKRVNECEKTLNLKLPIYIV
FSKLDLIEGMKEYFDIFDKKISDKILGLSFDKILSEEFLNNEFKELSDSLLCSLMSKNSHIYNIENKNKS
YLFLKQLDNLFALAKTFILEVQEENKLKNNSYLRGVYFVSAYQENIPRNFLLDAICEKYNCKKVLSKSNI
IHNKQSYFVKSLLEDLIFTDYSLSTMKSYSKKLSFLIIILIISFGTYAISSYFISKNNKEFEKSQNTLRS
LQLLLKDQDYQNLNIKQKADFLIELRNILNTYPELWQDNNIFQYLNLNLSYKGFKEAKQLYYKLNEDVLK
NTLLKEMEYTLLTDTNKENLIKTLYMYRSLFEQKYFNKEILKIWINENWNTLSKYSISKDDFLEGVDELK
QFNLKSFTEDENSIHTGKRKLESISRTQRIYILLNFLNSDKPKEKYLIKEDLGFAANSVFSNNSQITSID
KIYTKVGMMDFLNDLNQQVDTAINIESWMLDNNFKENKNTLTMGILKLYLSEYQNAWQNLLASLQPVRYN
TKEAMVNELNILSKKENPLYSLLKIVSSNTNLNDAVLLTQAYNLGLNAGEIRSNFIGVSNAFTQYHKLVN
KNTLLSVGNIEVGKGTDDEKILDILNTNITNMSNKIIDFSSNNNQSAEEKISYALGGNKDANDPFAVFQM
NIKKLPNDLERYYSQLSNYSWNFIENHGISLFNTAWINEVYNPFVNDIAPYYPFNDESVADLSMDSFKTF
FGRNXTLNSFYKKYLNNVLVKRKNNYSINSQFASKLNFSKEFLDFITNAGNLSSLILNGNDNIKVNFTIQ
SLDLSADFSFIKLGYGNKNIQYDHTLNQTLQIVAEKFNNGTSLNFTAYNYSNPNLNYTKSYKGEWAWYKF
IKDNKSNSIYSIIFNNNKNLYFDFEIINGASELNNIVYILNNLKIVENITGVNKQ
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|510027002|gb|JX436460|:897-4424
ATGTTTAAAAAAATATTTGATTTTGTGAAATCAAGATTATTTATAACTGCTTTTTTGCTTTGTTGTATTT
TTCTTTTGAGTATTTTATTTTGGTTTTGGGGTTCTTTAGTAGCTTTTAATGACATATATATTTTTAGTAG
TTCATTTTTAAGATTTAGTATTATTTTGATAATTTGGCTTATTGTTTTTTTGTTTTTTTTATTAAAGCCT
ATTATAAATTTTATATCTTCTTTAAAAAGTGAAAAAAGATTAAAATTTAAAGTCCTAAAAAAAGAAGCTG
ATGAGTTCACTTACAAATCTAAAAGAAACTTCTTTTTATCTCTTAAAGATGCCAAAGAAACATGGAAGAA
TGATTTAAAAACAAAAAATTTACCCTTAATTATCATCATAGGAAATGAAGGAGCTGGAAAAAGCACTTTT
ATTAATTATTCTGACATCGAATACCCACTTAGTGATAGTTTAGAGTCTTATAAAAAATTCCATAAATCTA
CTAGAAATTTTGCACTTTATGTATCAAAAAAAGGTGCTTTGTTAGATACAGAAGGAAACTATTTTTCACA
AGAAGAATTTTTTAAGCCTACAAGTAGCGATGAAATACCCGAAGATGATATAGATAAAAATAGAGATTTT
TTAATTAAAAAAAATATATGGAAAAAATTCCTTACTTTTCTCAATAAAAATTTTTTTCATAGCAAACTAA
ATGGAATTATTTTAGTTGTTGACACTGTAATTTTCTTAAATAATCCTAAGGAGTATTCCAAAAATCTTAT
TAGATATCTAACAAAAAGAGTAAATGAATGTGAAAAAACTTTAAATTTAAAACTGCCTATTTATATAGTT
TTTTCAAAACTCGACTTGATCGAAGGCATGAAAGAGTATTTTGATATTTTCGATAAAAAAATTTCAGATA
AAATTTTAGGATTATCTTTTGATAAAATCTTAAGTGAAGAATTTTTAAATAATGAATTTAAAGAATTAAG
TGATTCATTATTATGTTCCTTGATGAGTAAAAACTCCCATATTTATAATATAGAAAATAAAAATAAAAGC
TACTTATTTTTAAAACAACTTGATAATTTATTTGCATTAGCAAAGACTTTTATTTTGGAAGTGCAAGAAG
AAAATAAGCTTAAAAATAATTCTTATCTTAGAGGAGTTTATTTTGTTAGTGCCTATCAAGAAAATATTCC
TAGAAATTTCTTACTCGATGCCATATGTGAGAAATATAACTGCAAAAAAGTATTATCAAAATCCAATATT
ATACATAATAAACAAAGCTATTTTGTTAAATCACTGCTCGAAGATTTAATTTTTACAGATTATTCTTTAA
GCACTATGAAATCTTATTCTAAAAAATTATCTTTTTTAATTATAATTTTAATCATAAGCTTTGGAACATA
TGCTATATCTTCTTATTTTATAAGTAAAAATAATAAAGAATTCGAAAAAAGCCAAAACACCTTAAGATCT
TTACAATTGCTTCTTAAAGATCAAGATTATCAAAATTTAAATATTAAACAAAAAGCTGACTTCTTAATTG
AATTGAGAAATATTTTAAATACTTATCCTGAACTTTGGCAAGATAATAATATATTTCAATATTTAAATCT
AAATCTCTCATACAAAGGATTTAAAGAAGCTAAACAACTTTATTATAAACTGAATGAAGATGTGTTAAAA
AATACTTTATTAAAAGAAATGGAATATACTTTACTTACCGATACAAATAAAGAAAATTTAATCAAAACAT
TATATATGTATAGATCTTTGTTTGAACAAAAATATTTTAATAAAGAAATACTAAAAATTTGGATTAACGA
GAATTGGAATACTTTAAGTAAGTATTCAATCTCTAAAGATGACTTTCTAGAAGGGGTGGATGAGCTTAAA
CAATTTAATCTTAAATCTTTTACAGAAGATGAAAACAGTATACATACAGGAAAAAGAAAACTTGAGAGTA
TAAGTAGAACTCAAAGAATTTACATTCTTCTTAATTTTTTAAATAGCGATAAACCTAAAGAAAAATATCT
TATAAAAGAGGATTTAGGTTTTGCTGCAAATAGTGTATTTTCAAATAACTCTCAAATAACTTCTATAGAT
AAAATATATACAAAAGTTGGTATGATGGACTTTTTAAATGATTTAAATCAACAAGTTGACACCGCAATCA
ATATTGAATCTTGGATGCTAGATAACAATTTTAAAGAAAATAAAAACACTTTGACTATGGGTATTTTAAA
ATTATACTTAAGTGAATACCAAAATGCTTGGCAAAATCTACTCGCTTCATTGCAACCTGTTAGGTATAAT
ACCAAAGAGGCAATGGTTAATGAGCTTAATATCTTATCAAAAAAAGAAAACCCTTTATATTCTTTGTTAA
AAATTGTTAGTTCTAATACAAATTTAAATGATGCAGTTTTACTAACTCAAGCCTACAATTTAGGGTTAAA
TGCTGGGGAAATTAGATCAAATTTTATTGGGGTAAGCAATGCTTTCACACAATATCATAAGCTAGTAAAC
AAAAATACACTTTTGAGTGTTGGTAATATAGAAGTGGGCAAAGGCACTGATGATGAAAAAATATTAGATA
TTCTTAATACAAATATTACAAATATGTCCAATAAAATTATAGATTTTAGTTCTAATAATAACCAAAGTGC
TGAAGAAAAAATTTCATATGCTCTTGGAGGCAATAAAGATGCCAATGATCCTTTTGCTGTATTTCAAATG
AACATAAAAAAATTACCTAATGATTTAGAGAGATATTATAGTCAGCTTTCTAATTATTCGTGGAATTTTA
TAGAAAATCATGGTATTTCTTTATTTAATACTGCTTGGATTAATGAAGTGTATAATCCATTTGTTAATGA
TATTGCACCATATTATCCTTTTAATGATGAGAGTGTAGCAGATCTTAGTATGGATAGTTTTAAAACATTT
TTTGGAAGAAATGRGACATTAAATAGTTTTTATAAAAAATACTTGAACAATGTTTTAGTAAAAAGAAAAA
ATAACTATTCTATCAATTCTCAATTTGCTTCAAAATTAAATTTCTCTAAAGAATTTTTAGATTTTATCAC
CAATGCAGGCAATCTCTCTAGTCTCATACTAAATGGTAATGATAATATAAAAGTTAATTTTACTATTCAA
AGCCTTGATTTAAGTGCGGATTTTTCCTTTATAAAGCTTGGCTATGGTAATAAAAATATCCAATATGATC
ATACTCTTAATCAAACCCTACAAATTGTAGCAGAAAAATTCAATAATGGAACAAGTTTAAATTTTACAGC
CTATAACTACTCTAATCCTAATTTAAATTATACAAAATCATATAAAGGGGAATGGGCATGGTATAAGTTT
ATAAAAGATAATAAAAGTAATTCTATATACAGCATTATATTTAACAATAATAAAAACTTATATTTTGACT
TTGAAATTATTAACGGTGCTAGTGAATTAAATAATATAGTTTATATTTTAAACAATCTTAAAATAGTAGA
AAATATTACAGGGGTAAATAAACAATGA
 Primer design