SecReT6
Protein ID: 510027004
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssD
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]4542..5057 [+]
ProductTssD
NoteTssD
UniProt IDR9TLR6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.20E-35, Aligned region: 6..156
Protein Sequence: 171 a.a.     [Download]
>gi|510027004|ref|AGN32396.1| TssD [Campylobacter jejuni]
MAEPAFIKIEGSTQGLISSGASTEASIGNRYKSGHEDEIMAQEVSHIVTVPVDQQSGQPSGQRVHKPFSF
TCSLNKSVPLLYNALTKGERLPTVEVHWFRTATSGGSEHFFTTKLEDAIITNIELIMPNAQESSNHDKTE
LLKVSMSYRKVVWEHTAAGTSGSDDWREGKA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|510027002|gb|JX436460|:4542-5057
ATGGCTGAACCAGCGTTTATAAAAATTGAAGGTTCCACACAAGGTTTGATTTCAAGCGGTGCATCTACTG
AAGCGAGTATTGGCAATAGATATAAATCGGGTCATGAAGATGAAATCATGGCTCAAGAGGTATCTCATAT
TGTAACCGTACCTGTTGATCAGCAAAGCGGACAACCTTCTGGACAAAGAGTTCATAAGCCTTTTTCTTTT
ACTTGCTCATTAAATAAATCTGTGCCTTTGCTATATAATGCACTTACCAAAGGAGAAAGACTTCCAACAG
TCGAAGTTCATTGGTTTAGAACCGCAACAAGTGGCGGATCTGAACATTTTTTTACTACAAAATTGGAAGA
TGCAATTATTACAAATATTGAATTAATAATGCCAAATGCGCAAGAGTCAAGTAATCATGATAAAACCGAG
CTTTTAAAAGTTTCAATGAGCTATAGAAAAGTAGTTTGGGAACACACTGCTGCTGGAACTAGCGGAAGTG
ATGATTGGAGAGAGGGCAAAGCTTAA
 Primer design