SecReT6
Protein ID: 510027005
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssL
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]5312..6085 [-]
ProductTssL
NoteTssL
UniProt IDR9THY1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-39, Aligned region: 25..231
Protein Sequence: 257 a.a.     [Download]
>gi|510027005|ref|AGN32397.1| TssL [Campylobacter jejuni]
MKEINEEKKALSLLLDSDFDGLKNNKIIDYSLELLLLSYRLSKISSMDTSSINQLRETLINKILDITAKL
SICKEYDEKEIIKFKYCLCVFIDESLMKNELFINFWAHNTLTVRLFDETLGGNNFYDIASSWINNPFKFK
DFLEFIYACLILGYKGKYNETKDRDEKIIHFCNNIATSLKPVYKIEEELAFNKAYKTGLKENIWQKFIRL
YFKKLIIVVPVLIILGVLSYSIFNLETNNLKVDNNISVLIKNLTHIE
 
Nucleotide Sequence: 774 bp     [Download]
>gi|510027002|gb|JX436460|:5312-6085
ATGAAAGAAATAAATGAAGAAAAAAAGGCATTAAGCTTACTTCTTGATTCAGATTTTGATGGTTTAAAAA
ACAATAAAATTATTGATTATTCTTTGGAGTTGCTTTTGCTTTCTTATAGACTTTCAAAAATAAGCTCTAT
GGATACAAGTAGTATTAATCAACTTAGAGAAACATTGATTAATAAAATTTTAGATATAACCGCTAAATTA
AGTATATGTAAAGAATATGATGAAAAAGAAATTATTAAATTCAAATATTGTCTTTGTGTCTTTATAGATG
AAAGCTTAATGAAAAATGAACTTTTTATTAATTTTTGGGCTCACAATACTCTAACTGTAAGGTTATTTGA
TGAAACTTTAGGCGGAAATAATTTTTATGATATTGCATCATCTTGGATTAATAACCCTTTTAAGTTTAAA
GATTTTTTGGAATTTATCTATGCTTGTTTAATTCTTGGTTATAAAGGAAAATATAATGAGACTAAGGATA
GAGATGAAAAAATAATTCATTTTTGCAATAATATTGCCACATCTTTAAAACCGGTTTATAAGATAGAAGA
AGAGTTAGCTTTTAATAAAGCATATAAAACTGGTTTGAAAGAAAATATTTGGCAAAAATTTATAAGATTG
TATTTTAAAAAACTTATTATCGTTGTGCCAGTATTGATTATATTAGGAGTATTAAGCTATTCAATTTTCA
ATTTAGAAACTAATAATCTTAAAGTGGATAATAATATATCCGTATTGATAAAAAATTTAACACATATAGA
ATAA
 Primer design