SecReT6
Protein ID: 510027006
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssK
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]6082..7479 [-]
ProductTssK
NoteTssK
UniProt IDR9TM49
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-120, Aligned region: 19..463
Protein Sequence: 465 a.a.     [Download]
>gi|510027006|ref|AGN32398.1| TssK [Campylobacter jejuni]
MANKLKVAWFDGLNIGQTHFEQQERFFNRNIDLKTINIYSNLYGIIDLEFSQEMLLQGKIALSKISGIAQ
DGSIFNAPEQDLLPEPIEINYESLIDSVVVLKIPIGVTDIADLSLRNTFPNSKFICLRNSIALRNYDDSK
SNVMDKIEDEYELENLTFTQEKKDLLLASLRLKLGILGNSTPDELELPIAKIKNIDINKKIELESDFIPT
CLNISKISTIRSFLEEIIFSINQHKKVLSNVFKGIDQTKNTLDFSTFLSLNLLKKWYLIFSHLSKKDKIH
PEFLYEKFLEFQGELAAFSNEESFLDFIPYKHDNLYNTFLNMMNNLRLLFSKITSPKYFIAKTSINGNGF
YDFIFDNSGILEESEIYFAIRADVTTEYLLNNFKIQSKIHTQSKIKNIVATQLEGLNVDQVPNVPSSIPY
LNGYVYYKLDKRDQLFKDFKNESIISMYLTNNIKNPDIIMWAVFQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|510027002|gb|JX436460|:6082-7479
ATGGCAAATAAATTAAAAGTTGCTTGGTTTGATGGACTTAATATTGGACAAACCCATTTTGAGCAGCAAG
AAAGATTTTTTAATAGAAATATAGATCTTAAAACTATAAATATATATAGTAATTTATATGGAATAATAGA
CTTGGAATTTTCTCAAGAGATGTTATTGCAAGGAAAAATTGCACTTTCTAAAATTTCAGGTATCGCACAA
GATGGAAGCATTTTTAATGCACCTGAGCAAGATTTGTTGCCTGAGCCTATTGAAATCAATTATGAATCTT
TAATTGATTCAGTTGTGGTATTAAAAATTCCTATCGGAGTTACTGATATTGCTGATTTATCTTTAAGAAA
TACTTTTCCAAATTCAAAGTTTATATGTCTTAGAAATAGTATTGCTTTAAGAAATTATGATGATTCAAAA
TCTAATGTAATGGACAAAATTGAAGATGAGTACGAACTTGAAAATCTGACTTTTACACAAGAGAAAAAAG
ATTTACTTCTTGCTAGTTTAAGATTAAAACTTGGCATTTTAGGTAATTCAACTCCTGATGAACTTGAATT
ACCAATTGCAAAAATTAAAAATATTGATATCAATAAAAAAATTGAATTAGAAAGTGATTTTATACCCACT
TGCTTAAATATCAGCAAAATATCTACCATAAGATCCTTTTTGGAAGAAATTATTTTTTCAATCAATCAAC
ATAAAAAAGTTCTATCTAATGTTTTTAAAGGAATCGATCAAACAAAAAATACATTGGATTTTAGCACTTT
TTTATCCCTTAATCTTTTAAAAAAATGGTATTTAATATTTTCACATCTATCAAAAAAAGATAAAATACAT
CCTGAATTTTTATACGAAAAATTTTTAGAATTTCAAGGAGAGCTTGCAGCTTTTAGCAACGAAGAATCTT
TTTTAGATTTTATTCCTTATAAACACGATAATCTTTATAATACTTTTTTAAATATGATGAATAATCTAAG
ATTGTTATTTTCTAAAATCACAAGCCCTAAATATTTTATAGCTAAGACCAGTATTAATGGCAATGGTTTT
TATGATTTTATTTTTGATAATTCGGGAATTTTAGAAGAAAGTGAAATTTATTTCGCAATTCGTGCAGATG
TTACTACAGAATATCTACTTAATAATTTTAAAATTCAAAGCAAGATACATACTCAAAGTAAAATTAAAAA
TATAGTCGCAACTCAGCTTGAAGGCTTAAATGTAGATCAAGTACCTAATGTTCCATCTAGCATTCCTTAT
TTAAATGGTTATGTTTATTATAAATTAGATAAAAGAGATCAACTGTTTAAAGATTTTAAAAATGAAAGTA
TCATTAGTATGTACTTGACCAACAATATAAAAAACCCTGATATTATAATGTGGGCGGTATTTCAATGA
 Primer design