SecReT6
Protein ID: 510027007
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssJ
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]7489..7935 [-]
ProductTssJ
NoteTssJ
UniProt IDR9TJM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-19, Aligned region: 20..144
Protein Sequence: 148 a.a.     [Download]
>gi|510027007|ref|AGN32399.1| TssJ [Campylobacter jejuni]
MFCKKSLFFLLPLFFCACSSVVSVKINNVENSNLNNRHDDVPVTAIVYQLKDIKKFEEASDIDLATREEG
VLGKDKLDSIKTQIAPKDNIIAVKVDEEEVPYVGILVLFANNTKKTTKIWAKTEDANGFGKNKYLKFEIS
KEGIKRIK
 
Nucleotide Sequence: 447 bp     [Download]
>gi|510027002|gb|JX436460|:7489-7935
ATGTTTTGCAAAAAAAGCTTATTTTTTTTATTGCCAYTATTCTTTTGCGCTTGCTCAAGTGTTGTTAGTG
TTAAGATAAATAATGTAGAGAATTCCAATCTTAATAATAGACATGATGATGTTCCTGTTACGGCTATTGT
ATATCAACTTAAGGATATTAAAAAATTTGAAGAAGCAAGTGATATAGATTTGGCTACTAGAGAAGAGGGG
GTGCTAGGCAAGGATAAACTTGATTCTATTAAAACGCAAATTGCACCTAAAGACAATATTATCGCGGTTA
AAGTAGATGAAGAAGAGGTTCCTTATGTAGGCATTCTTGTATTATTTGCAAATAATACAAAAAAAACAAC
AAAAATATGGGCAAAGACCGAAGATGCAAATGGGTTTGGGAAGAATAAGTATTTAAAATTTGAAATATCC
AAAGAAGGTATCAAAAGAATTAAATAG
 Primer design