SecReT6
Protein ID: 510027008
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssA
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]8061..9308 [+]
ProductTssA
NoteTssA
UniProt IDR9TIS4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 415 a.a.     [Download]
>gi|510027008|ref|AGN32400.1| TssA [Campylobacter jejuni]
MYFCDQLKNNLDELQEFQLLEDEMSKYKTLNHENISWDKVYQYSQFILLNHSLDFKICNYFLLSCFNLNN
EECFEKLLLLFQHLKKLIDENNAYILAQKRKIQNFIQNFIQEYNKTKVLISSEIVNQFITLFSEFENLLS
CNFAKIEIAQVAPQLPKYPVTQVSVNIRSDNINSLNEREYKNFYQKLAFELLEEDENNLNIYALFTQAMW
GKIRCLPECNNEKITKIRKPDADIIRILLSDKENDIEHIKCFMHELILNPFWIEGVQLFCDFLEKKKKNK
QLDILIILTSDFISKFDTIELLRFQNGDFICKEEVYKYFVKSKENKKSFFSSKKTDKEHTLQDFEQMLMN
IDKENFNNSIMNNINSLLDMVKIFESKGMKKNSKILNIYLVELMEKTLLKDYLAEEYENVKSKIK
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|510027002|gb|JX436460|:8061-9308
ATGTATTTTTGTGATCAATTGAAAAATAATTTAGATGAACTACAAGAATTTCAGTTACTTGAAGATGAGA
TGTCAAAATATAAGACTTTAAACCATGAAAATATTTCTTGGGATAAAGTTTATCAATATTCTCAGTTTAT
ATTATTAAATCATTCTTTAGATTTTAAAATTTGCAACTATTTTCTTTTATCGTGTTTTAATTTAAACAAT
GAAGAATGCTTTGAAAAGCTTTTGCTTCTTTTTCAACATTTAAAAAAACTTATAGATGAAAATAATGCTT
ATATATTAGCTCAAAAGCGAAAAATTCAAAATTTTATTCAAAATTTTATTCAAGAATACAATAAAACAAA
AGTGCTTATATCATCTGAGATTGTTAATCAATTTATTACTTTATTTTCCGAATTTGAAAATTTACTATCT
TGCAATTTTGCAAAAATTGAAATTGCTCAAGTTGCACCACAACTTCCAAAATATCCTGTAACTCAAGTAT
CTGTAAACATTAGAAGCGATAATATTAACTCTTTAAACGAGAGAGAATATAAAAATTTTTATCAAAAACT
TGCATTTGAGCTTTTGGAAGAGGATGAAAATAATCTCAATATCTACGCTTTATTCACCCAAGCAATGTGG
GGAAAAATCAGGTGTTTACCTGAATGTAATAATGAAAAAATTACTAAAATAAGAAAACCTGATGCAGATA
TAATTCGCATATTACTTTCTGATAAAGAAAATGATATAGAACATATTAAATGTTTTATGCATGAACTTAT
TTTAAATCCTTTTTGGATAGAGGGTGTACAACTCTTTTGTGATTTTTTAGAAAAAAAGAAAAAAAATAAA
CAATTAGACATTCTTATAATATTAACAAGTGATTTTATTTCTAAATTTGATACTATTGAACTTCTCCGTT
TTCAAAATGGTGATTTTATCTGCAAAGAAGAAGTTTATAAATATTTTGTTAAATCCAAAGAAAATAAAAA
AAGTTTTTTTTCAAGTAAAAAAACTGACAAAGAACATACATTACAAGATTTTGAGCAAATGCTGATGAAT
ATTGATAAAGAAAATTTTAATAATTCTATTATGAATAATATTAATTCCTTGCTAGATATGGTAAAAATTT
TTGAATCAAAAGGAATGAAAAAGAACTCTAAAATTTTAAATATATACTTAGTAGAGTTAATGGAGAAAAC
TCTACTAAAAGATTATCTAGCCGAAGAATACGAAAACGTAAAAAGTAAAATTAAGTGA
 Primer design