SecReT6
Protein ID: 510027009
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssB
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]9377..9862 [+]
ProductTssB
NoteTssB
UniProt IDR9TLS2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-54, Aligned region: 5..156
Protein Sequence: 161 a.a.     [Download]
>gi|510027009|ref|AGN32401.1| TssB [Campylobacter jejuni]
MSDGSYAPKERINITYKAKTNGQNEDVELPLKLMVMANLKGKNETPLEEREILQINKINFDQVMRKLNIT
TSFSVKNTLGTGAEELDVKLNIASMKDFSPDSLAKQIPELNKLLQLREALMALKGPMGNIPDFRKAVLEA
LKNEKTKEKLLLEIKQEEQGN
 
Nucleotide Sequence: 486 bp     [Download]
>gi|510027002|gb|JX436460|:9377-9862
ATGTCAGATGGATCTTATGCTCCAAAAGAGCGGATTAATATTACATATAAAGCTAAAACTAATGGACAAA
ATGAGGATGTGGAGTTGCCGTTAAAATTAATGGTAATGGCAAATTTAAAAGGAAAAAACGAAACTCCTTT
AGAGGAAAGAGAAATTTTGCAAATTAATAAGATTAATTTTGATCAAGTCATGAGAAAACTCAATATAACA
ACAAGTTTTAGCGTAAAAAACACTCTTGGAACAGGAGCTGAAGAGCTTGATGTTAAGCTCAATATTGCTA
GTATGAAGGATTTTTCTCCAGATAGCTTAGCTAAACAAATACCCGAGCTAAACAAATTATTGCAGCTAAG
AGAAGCATTAATGGCTTTAAAAGGYCCTATGGGTAATATTCCTGATTTTAGAAAAGCTGTTTTAGAAGCG
TTAAAAAATGAAAAAACTAAAGAAAAATTACTTTTAGAAATTAAACAAGAAGAGCAAGGAAATTAA
 Primer design