SecReT6
Protein ID: 510027010
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssC
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]9864..11318 [+]
ProductTssC
NoteTssC
UniProt IDR9THZ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-177, Aligned region: 57..482
Protein Sequence: 484 a.a.     [Download]
>gi|510027010|ref|AGN32402.1| TssC [Campylobacter jejuni]
MANTKAVDMPIIEQIMEKSKYSKTDESFSIAKRGVAEFISEIVKSDNAEEKINKFALDEMIAHIDYLLSK
QMDEVLHNEEFQKLESTWRGLRFLVERTDFNENIKIDLFDIRKEEALEDFENNPDITQSVVYKNIYSSEY
XQFGGEPIGAIIGDYQLGSASPDMTFLNKMASIAAMSHSPFLTSFGPKFFGLDDYSELANIQDLQGLLEG
PQYTRWRTFRENEDSKYTGLLVTRFLARSPYDPEENPIKSFNYKENVHASHNHLLWANSSYTFCTRLTES
FAKYRWCGNIIGPKSGGTVKDLPTYLYENFGTIQSKIPTEVLITDRREYELAEAGFITLTLRRDSNNAAF
FSANSPLKPKLFQNTPEGKEAETNYRLGTQLPYIFLISRLAHYLKVLQREEIGSWKERSDIENGLNEWIR
QYISDQENPPSEVRSRRPFRAAQVKVSDIPGEPGWYKIGLSVRPHFKYMGGNFELSLVGKLDKE
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|510027002|gb|JX436460|:9864-11318
ATGGCAAATACTAAAGCAGTTGATATGCCAATTATTGAACAAATTATGGAGAAAAGCAAATACTCTAAAA
CCGATGAAAGTTTTAGTATTGCTAAAAGAGGTGTTGCTGAATTTATTTCAGAAATTGTAAAAAGCGACAA
TGCTGAAGAAAAAATCAATAAATTTGCACTTGATGAAATGATAGCCCATATTGATTATTTACTCTCAAAA
CAAATGGATGAAGTTTTACATAATGAAGAATTTCAAAAACTTGAATCTACTTGGCGTGGACTTAGATTTC
TAGTTGAAAGAACTGATTTTAATGAAAATATAAAAATTGACCTATTTGATATAAGAAAAGAAGAAGCTTT
AGAGGATTTTGAAAACAATCCAGATATAACACAAAGCGTTGTTTATAAAAATATATATTCTTCAGAATAT
RGACAATTTGGAGGAGAGCCTATAGGAGCAATCATTGGAGATTATCAACTTGGATCAGCAAGTCCTGATA
TGACTTTTTTAAATAAAATGGCTAGTATTGCGGCTATGAGTCATTCTCCCTTTTTAACATCTTTTGGACC
AAAATTTTTTGGGCTTGATGATTATTCTGAACTTGCGAATATTCAAGATTTGCAAGGTTTGCTAGAAGGT
CCTCAATATACAAGGTGGAGAACTTTTAGAGAAAATGAAGACTCTAAATATACAGGCTTACTAGTGACAA
GATTTTTAGCAAGAAGCCCTTATGATCCTGAAGAAAACCCTATTAAAAGCTTTAACTATAAAGAAAATGT
TCATGCTTCGCATAATCATTTATTGTGGGCTAATTCTTCGTATACTTTTTGTACAAGATTAACAGAAAGC
TTTGCTAAATATAGATGGTGTGGAAATATTATAGGACCAAAAAGTGGAGGGACTGTTAAGGATCTGCCTA
CTTATCTTTATGAAAATTTTGGAACTATACAATCAAAAATACCTACAGAAGTTTTGATTACAGATAGGAG
AGAGTATGAACTTGCTGAAGCAGGTTTTATAACCTTAACATTAAGAAGAGATAGTAATAATGCAGCATTT
TTTTCAGCAAATTCTCCGTTAAAACCAAAATTATTTCAAAATACCCCAGAAGGTAAAGAAGCTGAAACAA
ATTACAGATTAGGAACTCAACTTCCATATATCTTTTTAATTTCAAGATTGGCGCACTATTTAAAGGTTTT
ACAACGAGAAGAAATAGGGAGCTGGAAAGAAAGAAGCGATATTGAAAATGGACTTAATGAATGGATTAGA
CAATATATTTCCGATCAAGAAAATCCACCTTCTGAAGTAAGAAGTCGTCGTCCATTTAGAGCAGCACAAG
TGAAAGTTAGTGATATACCAGGAGAGCCAGGATGGTATAAAATAGGGCTAAGTGTCCGACCTCATTTTAA
ATATATGGGCGGTAATTTTGAACTTTCTTTAGTAGGAAAATTAGATAAAGAATAA
 Primer design