SecReT6
Protein ID: 510027011
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssE
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]11321..11713 [+]
ProductTssE
NoteTssE
UniProt IDR9TM59
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.90E-13, Aligned region: 24..110
Protein Sequence: 130 a.a.     [Download]
>gi|510027011|ref|AGN32403.1| TssE [Campylobacter jejuni]
MSLLDKLIHNLDEQNIHIPFYQNDFEDVKNNIKVLLNAKINDCYAVKNLGMXNMADINLNSNELCVSMAK
EIRKLIDNYEKRICVVSITYDNNLSPWQLSFIVKCFFQDDRFKEFNIEIIFKNNRYCEVK
 
Nucleotide Sequence: 393 bp     [Download]
>gi|510027002|gb|JX436460|:11321-11713
ATGTCCTTGCTAGATAAACTGATCCATAATTTAGATGAGCAAAACATTCATATTCCATTCTATCAAAATG
ATTTTGAGGATGTAAAAAACAATATAAAGGTTTTGCTCAATGCAAAAATTAATGATTGTTATGCTGTAAA
AAATTTAGGAATGYCTAATATGGCTGATATTAATCTTAACTCTAATGAATTATGCGTATCAATGGCCAAG
GAAATAAGAAAACTAATTGATAACTATGAAAAAAGAATATGTGTAGTTTCTATCACTTATGATAAYAATT
TAAGTCCTTGGCAACTTTCTTTTATTGTAAAATGTTTTTTTCAGGATGATCGTTTTAAAGAATTYAATAT
AGAAATCATCTTTAAAAACAATAGATATTGCGAGGTTAAATGA
 Primer design