SecReT6
Protein ID: 510027012
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssF
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]11710..13431 [+]
ProductTssF
NoteTssF
UniProt IDR9TJM9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.10E-134, Aligned region: 7..573
Protein Sequence: 573 a.a.     [Download]
>gi|510027012|ref|AGN32404.1| TssF [Campylobacter jejuni]
MKDNIFYYQKELEYLYEKREYFIKNYPKLTPFLAYDSIDPDIERIIENLASLSSKIHQELDENIPHIAES
LINIVSPNYTNPLPSLCMQEFKFEQNSKENNLIIPKGTLIKSKPIDKCVCEFKTVYDVYLYSISISEVFI
SSKNQDYTFNLTLQVNKAETKICDLGLEKINLYLGNDTYMSSTLLLYMHSYLKELKIQXLDTDEEFFLNT
YNXEKIGLNPDESSLSYNDLGFEAFSLLREYFFMPHKFNFLRINGLDILNNCQGKTINIEFKFSKPFPAN
CIFRKELLSLSMTPIINIFTKSAEPLINNHKKDSYRIFVDRSQPKAYEIIQTLQVKAHNSEGGKRLLKNY
KSFERFEFLKDNQKDFYSVNTKKNSKGEVFSEISFFSSYIMDETISIDLLCSNGDLPSKLKIGDINTCDL
KGVDTKNVEIPSETRRCSVDGNLLWKLVSVLSFSYQTILSKKAFFGVLESYSFLDNQSNWKIYKLLQESI
IDIQSKSTYLIDENITKKGTLAIFSIKDSKFYTLGEVYLLGLIISKFLASFASINSFCELKIRCLDSKEI
LHYPASFGKKALI
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|510027002|gb|JX436460|:11710-13431
ATGAAGGATAATATTTTTTATTATCAAAAAGAGCTTGAATATCTATATGAAAAAAGAGAGTATTTTATAA
AAAATTATCCAAAGTTAACACCATTTTTGGCATATGATAGCATAGATCCTGATATAGAAAGAATTATTGA
AAATTTAGCTAGTTTAAGCTCTAAAATCCATCAAGAGCTTGATGAAAATATACCACACATTGCAGAATCT
TTGATTAATATTGTTTCTCCAAATTATACAAATCCTTTACCTTCTTTATGCATGCAAGAATTTAAATTTG
AACAAAATAGTAAAGAAAATAACTTAATTATTCCCAAAGGAACTCTTATTAAATCAAAACCAATAGACAA
ATGTGTTTGTGAATTTAAAACAGTATATGATGTTTATCTTTATTCTATCTCCATCAGCGAAGTTTTTATA
TCTAGTAAAAATCAAGATTATACTTTCAATTTAACTTTGCAAGTCAATAAGGCAGAAACAAAAATATGTG
ATTTGGGTTTGGAAAAAATTAATTTATATCTAGGCAATGATACCTATATGTCTAGTACTTTATTATTATA
CATGCATTCTTATTTAAAAGAATTAAAAATTCAARGTTTAGATACTGATGAAGAATTTTTTCTTAATACC
TATAATATKGAAAAAATAGGATTGAATCCAGATGAAAGTAGTTTATCTTATAATGATTTAGGTTTTGAAG
CATTTTCCTTACTAAGAGAATATTTTTTCATGCCACATAAATTCAATTTTTTAAGAATCAATGGTTTGGA
TATTTTAAATAATTGTCAAGGAAAGACAATTAATATTGAATTTAAATTCTCTAAACCATTTCCTGCAAAT
TGTATTTTTAGAAAAGAATTACTTTCTTTAAGCATGACACCTATTATCAATATCTTTACAAAAAGCGCAG
AACCTCTTATAAATAATCACAAAAAAGATAGTTATAGAATTTTTGTGGATAGAAGCCAACCTAAAGCTTA
CGAAATCATACAGACACTACAGGTTAAAGCACATAATAGTGAAGGCGGCAAAAGGTTATTAAAAAACTAT
AAAAGTTTTGAACGCTTTGAATTTTTAAAAGATAATCAAAAGGATTTTTATAGCGTAAATACTAAAAAAA
ATTCCAAAGGAGAGGTATTTAGCGAAATTTCTTTCTTTTCCTCTTATATAATGGATGAAACTATAAGTAT
TGATCTTTTGTGCTCCAATGGAGATTTACCTTCAAAATTAAAAATAGGTGATATTAATACCTGCGATCTA
AAAGGTGTCGATACCAAAAATGTGGAAATTCCAAGCGAAACAAGAAGATGTAGTGTTGATGGTAATTTAT
TATGGAAGCTTGTTTCTGTGTTATCTTTTTCATATCAAACAATATTGAGCAAAAAAGCTTTTTTTGGTGT
GTTGGAAAGCTATAGCTTTTTAGATAATCAATCAAATTGGAAGATTTATAAGCTTTTGCAAGAATCTATA
ATCGATATTCAAAGTAAAAGCACTTATTTAATAGATGAAAATATCACAAAAAAAGGGACCTTAGCTATTT
TTAGTATTAAAGATTCGAAGTTTTACACTTTAGGCGAGGTATATTTATTGGGATTGATTATATCTAAATT
TTTAGCTTCTTTTGCTAGTATTAACTCCTTTTGTGAGTTAAAAATAAGATGCCTCGACTCAAAAGAAATT
TTACATTACCCTGCTTCTTTTGGAAAAAAAGCTTTAATATGA
 Primer design