SecReT6
Protein ID: 510027013
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssG
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]13428..14336 [+]
ProductTssG
NoteTssG
UniProt IDR9TIT3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-53, Aligned region: 3..287
Protein Sequence: 302 a.a.     [Download]
>gi|510027013|ref|AGN32405.1| TssG [Campylobacter jejuni]
MNNLTSYSFFKLIKKLEKDYGRKNIFLRTNKSLKHPNKDIEKIIFSEHEQSVIELFINFMGLHGVSSQLP
SFMLDKLSRNEDGDQGWTLFFDFFNHYLLWIFFDVISLKNYPRSFNENFKDSISKILFSMLGIKEYDIAK
KYLPFAPLLLSLRRPKTHIERVLQVNFKLKDKLSIIENLPHQILISNSQKNNLGIKNNILGNNFILGDKF
ISYQNKIAIYIKDISYQEAVKFMPNGTKHDDLKNSIMFLTNNEFCVDLYLKINYSSEMKFVLGEENTAKL
GWAKILGNTQKKYTIVYMKLCE
 
Nucleotide Sequence: 909 bp     [Download]
>gi|510027002|gb|JX436460|:13428-14336
ATGAATAATCTTACTTCATATAGTTTTTTTAAATTAATAAAAAAATTAGAAAAAGACTATGGAAGAAAGA
ATATATTTTTAAGAACAAATAAAAGTTTAAAACATCCAAATAAAGATATAGAAAAAATCATTTTTTCAGA
ACACGAACAATCAGTTATAGAATTGTTTATAAATTTCATGGGGCTACATGGAGTCTCTTCACAACTTCCT
TCATTTATGCTAGATAAACTGTCAAGAAATGAAGATGGCGATCAAGGTTGGACTCTATTCTTTGATTTCT
TTAATCATTATTTGCTTTGGATATTTTTTGATGTAATAAGCTTAAAAAATTATCCACGATCTTTTAATGA
AAATTTTAAAGATTCTATTTCAAAAATTTTATTTAGCATGTTGGGAATTAAAGAATACGATATTGCAAAA
AAATATTTACCATTTGCACCTTTACTACTAAGTTTAAGACGACCTAAAACACACATTGAAAGAGTTTTAC
AAGTCAATTTTAAACTTAAGGATAAATTATCAATTATTGAAAATTTACCCCATCAAATTTTAATTTCAAA
TTCGCAAAAAAATAACTTAGGAATAAAGAACAATATTTTAGGAAATAATTTTATATTGGGCGATAAATTT
ATCTCTTATCAAAACAAAATAGCGATCTATATAAAGGATATTTCATATCAAGAAGCGGTTAAATTTATGC
CCAATGGAACCAAACACGATGATTTAAAAAATAGCATAATGTTTTTAACAAATAATGAATTTTGTGTTGA
TTTATATCTTAAAATCAACTATTCTTCAGAAATGAAGTTTGTGTTAGGAGAAGAAAATACTGCCAAACTT
GGTTGGGCAAAAATTTTAGGTAATACGCAAAAAAAATATACAATAGTATATATGAAACTATGTGAATAA
 Primer design