SecReT6
Protein ID: 510027014
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTssI
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]14486..17002 [+]
ProductTssI
NoteTssI
UniProt IDR9TLS9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-16, Aligned region: 76..290
Phage_base_V [PF04717], Evalue: 3.70E-13, Aligned region: 471..567
Protein Sequence: 838 a.a.     [Download]
>gi|510027014|ref|AGN32406.1| TssI [Campylobacter jejuni]
MSLNSYMSLNISNSTSNPLPFKITKALIKESLEELFSIECEGFFESLEQDLFSLNTLTNASSHLSTPTTF
NFHPNVLIDQEAILSIHNPYENNTLNFDNNEVKNYKGIITYIKYLGINHESALSINDSTSNTKQIQYKHF
FSFKLQSVLIRLSLNKANRIYTHANIIEVIKQTLGFYQDILHKEIDYSNIHFNYEEQELISQYNESDLDF
ITRLSHNNGIFFYEDENTIYFCDVYKNVKNKEIEYNPNINNILNQACISSIYKEQSLRTNSFTHSSINAN
TPLNLLSLHSSKVPYEQELNNKACYNEHFYESEYSFTKSIDLKTKPSLKEKRALVLNESLLAKSNIYHLS
LGDFITLNYKEFNHQEEIKNQDEEKQDKASLLKDFIIIANTQILIDDAILANSINTNDHLNLKDLNLSKS
YSNTLTLLKKNIIFTPSFKAKPKAPNSTQGIVIGESKDIESERNTIYTDEHGRVKVRINLYANQEELDNN
TFITNDIDTNSSNLSSNTYKSYHHTPFLRVASHIASNHSGFFHTPRIGDEVIISFLDDDIDKPYVSGSLY
NGANPSLVNLPFNDHQTSLSSKTIGVNEEGYNELTLSNIKDKEQIYLKAQKDYDELVQHNFTQRILNDKD
SIVDGIYNERIKKVHTQTIDLAKNVNVGGEYLTNVGLSKDTIVGLSNTLNVGVDNKVRVAKNSHEFVGEN
KDIEIGANQNTIIHKDEIRNVKGNKKEVVEGHYDINISDKMQVLSEKEMDYKSKDNILFTSNESIGFESD
KNTSMVADNITTYAKTIHELKADSEATIQVGETIINAKPDCVIIKAGGVEVTIDSNGLVVKGGEIKAE
 
Nucleotide Sequence: 2517 bp     [Download]
>gi|510027002|gb|JX436460|:14486-17002
ATGTCCCTTAATTCTTACATGAGTCTTAATATATCAAATTCTACTTCAAATCCCCTACCCTTTAAAATCA
CTAAAGCCCTCATCAAAGAAAGTCTTGAAGAGCTTTTTTCTATAGAATGTGAAGGCTTTTTTGAAAGTTT
AGAACAAGATTTATTTTCTTTAAATACTTTAACCAATGCTTCATCTCATCTAAGCACCCCTACAACTTTT
AATTTTCATCCTAATGTTTTAATCGATCAAGAAGCTATTTTAAGTATCCATAATCCTTATGAGAATAATA
CCTTAAACTTTGATAACAATGAAGTAAAAAACTATAAGGGAATTATCACTTATATAAAATATCTAGGTAT
TAATCATGAAAGTGCTTTAAGTATTAATGATAGCACTTCAAATACTAAGCAAATACAATACAAGCATTTT
TTTTCTTTTAAGCTTCAATCAGTCTTGATAAGACTTTCTTTAAATAAAGCCAATCGTATTTATACTCATG
CTAATATTATAGAAGTGATTAAACAAACCCTTGGTTTTTATCAAGACATCTTACATAAAGAAATTGATTA
TTCTAATATACATTTTAATTATGAAGAACAAGAACTCATCTCTCAATACAATGAAAGTGATTTAGACTTT
ATTACAAGATTAAGCCATAATAATGGAATCTTTTTTTATGAAGATGAGAACACTATTTATTTTTGTGATG
TATATAAAAATGTAAAAAATAAAGAAATTGAGTATAATCCTAATATTAATAATATTTTAAATCAAGCTTG
TATTTCTTCTATTTATAAAGAGCAAAGCTTAAGAACTAATTCTTTTACACATTCTAGTATTAATGCCAAT
ACTCCTTTAAATCTTTTATCTTTACACTCTAGTAAAGTTCCTTATGAACAAGAACTTAATAACAAAGCTT
GTTATAATGAACATTTTTATGAGAGTGAATATTCTTTTACAAAAAGCATTGATTTAAAGACTAAGCCTTC
TCTTAAAGAAAAAAGAGCCTTAGTATTAAATGAAAGCTTACTAGCAAAAAGTAATATTTATCATCTTAGC
TTAGGAGATTTTATCACTTTAAATTATAAGGAGTTTAATCATCAAGAAGAAATAAAAAATCAAGATGAAG
AAAAACAAGATAAAGCTTCTTTGCTTAAAGACTTTATTATTATCGCTAATACTCAAATCTTAATTGATGA
TGCCATCTTAGCTAATTCTATTAATACTAATGATCATTTAAATTTAAAAGATTTAAATTTAAGTAAATCT
TATTCTAATACTTTAACTTTACTAAAAAAGAATATTATCTTTACTCCAAGTTTTAAAGCTAAACCTAAAG
CTCCTAATAGCACTCAAGGTATTGTTATAGGAGAGAGTAAGGATATAGAAAGTGAGAGAAATACTATTTA
TACTGATGAGCATGGAAGGGTTAAGGTAAGGATTAATCTTTATGCCAATCAAGAAGAATTAGATAATAAT
ACTTTTATTACAAATGATATAGATACAAATTCTTCTAATTTATCAAGCAATACTTACAAATCTTATCATC
ACACTCCTTTTTTAAGAGTAGCTTCTCATATAGCAAGTAATCATTCAGGTTTTTTTCATACTCCAAGAAT
AGGAGATGAAGTGATTATTTCTTTTTTAGATGATGATATAGATAAACCTTATGTAAGTGGAAGTTTGTAT
AATGGGGCTAATCCAAGTTTAGTAAATCTTCCTTTTAATGATCACCAAACTTCTCTTTCTTCTAAAACCA
TAGGTGTTAATGAAGAAGGTTATAATGAACTTACCCTCTCAAATATAAAAGATAAAGAACAAATTTATTT
AAAAGCCCAAAAGGATTATGATGAATTAGTACAACATAATTTCACTCAAAGAATTTTAAATGATAAAGAT
TCTATAGTGGATGGAATTTATAATGAAAGGATTAAAAAGGTTCATACTCAAACCATAGACTTAGCTAAAA
ATGTCAATGTAGGAGGAGAATACTTAACTAATGTAGGCTTATCTAAAGATACCATAGTAGGATTAAGCAA
TACCTTAAATGTAGGAGTAGATAATAAAGTAAGAGTGGCTAAAAACTCTCATGAGTTTGTAGGAGAAAAC
AAAGATATAGAAATAGGTGCTAATCAAAATACTATTATCCATAAAGATGAGATAAGGAATGTGAAGGGAA
ATAAAAAGGAAGTGGTTGAGGGGCATTATGATATTAATATCAGCGATAAAATGCAAGTATTAAGCGAGAA
AGAGATGGATTATAAAAGCAAAGACAATATTCTTTTTACAAGTAATGAATCCATAGGATTTGAAAGTGAT
AAAAATACAAGCATGGTAGCTGATAATATCACAACTTACGCAAAAACTATTCATGAGTTAAAAGCCGATA
GCGAAGCGACTATACAGGTAGGAGAAACAATTATTAATGCAAAACCTGATTGTGTTATCATTAAAGCAGG
TGGAGTTGAAGTAACTATAGACTCTAATGGACTTGTGGTCAAAGGTGGAGAGATTAAAGCAGAGTAA
 Primer design