SecReT6
Protein ID: 510027015
SecReT6 ID928
T6SS typei1
Gene symbol-
Locus tagTagH
StrainCampylobacter jejuni 108
Repliconchromosome [GenBank: JX436460] [Browse all T6SS(s) in this replicon]
Location [Strand]1..900 [-]
ProductTagH
NoteFha
UniProt IDR9THZ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.10E-05, Aligned region: 32..100
Protein Sequence: 299 a.a.     [Download]
>gi|510027015|ref|AGN32407.1| TagH [Campylobacter jejuni]
MIEKEEIGIAIENYDECINGSKTFVFNTKGGTIGSGDDCTFRIQDKLEQIKNTHAIVSYEEGSFTIAAFE
DSDIYYNKSFSRMPSGYEIIISIGDVFKIGNLEFRFVDAKSIEASIKENKKYLEDIEKRNHFDEIEIKPR
GKTSINFDKNKELKEILENNDYKFIEEEKADDSFLKEIIQKNPNSLEYENVLKSLVKNLKDIKTKQQNSK
LNNDYSPISIKDFESIINNIPLIKSTRLINILALSLIAKELYTPIFEEMEENMFIKYIEAAIQNNIKEDK
ILFENLTIKALEKYIKDFE
 
Nucleotide Sequence: 900 bp     [Download]
>gi|510027002|gb|JX436460|:1-900
ATGATAGAAAAAGAAGAAATAGGAATTGCTATTGAGAATTATGACGAATGTATTAATGGTTCTAAAACAT
TTGTATTTAACACAAAGGGTGGAACTATAGGAAGCGGTGATGATTGCACTTTTCGTATTCAAGATAAACT
AGAACAAATCAAAAATACCCATGCCATAGTATCTTATGAAGAAGGATCTTTTACAATTGCGGCTTTTGAA
GATTCTGACATTTATTATAATAAGTCCTTTTCTAGAATGCCAAGTGGCTATGAAATAATAATCAGCATAG
GCGATGTTTTTAAAATCGGTAATTTAGAATTTAGATTTGTGGATGCAAAAAGCATTGAAGCAAGCATTAA
AGAAAATAAAAAATACTTAGAAGATATTGAAAAACGCAATCATTTTGATGAAATTGAAATTAAACCTAGA
GGAAAAACAAGTATAAATTTTGACAAAAACAAAGAGTTAAAAGAGATTTTAGAAAATAATGATTATAAAT
TTATCGAAGAAGAAAAGGCAGATGATAGCTTTTTAAAAGAAATAATTCAAAAAAATCCAAATTCATTAGA
ATATGAAAATGTTTTAAAAAGTTTGGTAAAAAATTTAAAAGATATTAAAACAAAACAACAAAACTCTAAA
TTAAATAATGATTATTCTCCTATCAGTATTAAAGATTTTGAAAGTATTATTAATAATATACCCTTAATCA
AATCCACAAGATTGATCAATATTTTAGCCCTTAGCCTAATCGCAAAAGAATTATATACTCCAATATTTGA
AGAAATGGAAGAAAATATGTTTATTAAATATATTGAAGCTGCCATACAAAACAATATCAAAGAAGATAAG
ATTCTTTTTGAAAATCTTACCATCAAAGCATTGGAAAAGTATATTAAAGATTTTGAGTGA
 Primer design