SecReT6
Protein ID: 512615824
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01710
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]188322..191648 [+]
Producthypothetical protein
NoteTssM
UniProt IDS6AL05
KEGG IDpre:PCA10_01710
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.60E-71, Aligned region: 393..709
DUF1215 [PF06744], Evalue: 4.70E-33, Aligned region: 830..949
DUF72 [PF01904], Evalue: 0.0083, Aligned region: 154..291
DUF72 [PF01904], Evalue: 0.0083, Aligned region: 620..709
Protein Sequence: 1108 a.a.     [Download]
>gi|512615824|ref|YP_008100508.1| hypothetical protein PCA10_01710 [Pseudomonas resinovorans NBRC 106553]
MYRVLGYLAVITLLVLAGCVLYLLLGESLDLPSLPLSRLLLWAALGWLILGAFCPLYLWAWERLTIGLAR
RVTGDMPAADEAPTKLKSGSGNALPALRTHLQENIGLFWRHKVRLLLVLGEPDEVRAIAPALAEQQWLEG
DGAVLLWGGDGSNEALLEQWRRLRPRRPLDAIVWALNPEQSADSDYLGRYLGHLQALTRRLRWRAPLHFW
EVRRSDWMQPAADAEVGCLLAAHAGQAQLEDQLDRLLQPLREQGLARMRGDNREDFLLRLAHDLQHHGIA
RWQRAWAQLRRGPGLLPRGLWFSLALPAAPGGAKHAWQAHPAWRGVLDNKALGGRVQGWTWPRIGTALAL
GLAVLWGLGLLLSFVGNRAQVAELETVLAALDQPREGDEHVLALNELVHELDRLDHRAQHGVPWYQGFGL
SQNDALLAALWPRYQAANNRLLRDPAAARLESGLRELLALPPGSPERALHVQGAHASLKAYLMMARPERA
DAAFLGKTLAALEPERAGIGDGVWQGIAPNLWRFYAEQLAAHPEWRIEADAALIAQARQVLLGQLGQRNG
EASLYEAVLEATASQYPPLGLQQLVGDTDAQWLFSTDAEVPGVFTRQAWEGRVRKAIDEAASARREEIDW
VLSDDQSQVAAELSPEALRERLTARYFQDYGNAWLGVLNSLRWQPANSLAEVIDQLTLMADVRQSPLIAL
MNTLAYQGQAGTRRQALGDSLVQSAQKLIGQDQAPVIDVQALAPEGPLDDSFGPLLALLGKGDALAGEDR
LSLQAFLTRVTRVRLKLQQVSTSPDPQAMIQDLAQTVFQGRSVDLADTQAYGSLVAASLGSEWNGFGQAL
FVQPLDQAWRRILQPSAAGLNAQWQRAIVAPWDAAFAGRYPFAATASDASLPMLGLMIRGDSGRIDQFLA
RQLGGVLRKEGHRWVPEAAQSQGLRFNPEFLAAVNRLNDLADVLYTDGGMGIGFELQAKPVRDVEQTTFI
LDGNRLTYFNQRERWQRFTWPGTGDHPGANLRWTSVKAGERLFGDYPGTWGLIRLLEQARATPLDDGHSR
YRLVLQAPDGLGLTWHLRTELGAGPLALLQLRGFKLPARIFLEDGGTPLSLMTHGELP
 
Nucleotide Sequence: 3327 bp     [Download]
>gi|512615653|ref|NC_021499.1|:188322-191648 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
TTGTATCGGGTGCTGGGCTATCTGGCGGTGATTACGCTGCTGGTACTGGCCGGTTGCGTGCTGTACCTGC
TGCTGGGGGAATCACTGGATTTGCCCAGCTTGCCTCTGTCGCGCCTGTTGCTCTGGGCGGCGCTGGGTTG
GCTAATCCTTGGCGCCTTCTGCCCACTGTACCTGTGGGCCTGGGAACGTCTGACGATTGGACTGGCACGA
CGGGTAACCGGTGACATGCCGGCGGCGGACGAAGCGCCGACAAAGCTCAAGTCTGGCTCGGGGAATGCGC
TGCCCGCACTGCGCACCCACCTGCAAGAAAACATCGGCCTGTTCTGGCGCCACAAGGTGCGTCTGCTGCT
GGTGCTCGGCGAGCCGGACGAGGTGCGCGCCATCGCGCCGGCCCTGGCTGAGCAGCAATGGCTGGAAGGC
GACGGCGCGGTGCTGCTGTGGGGCGGGGACGGTTCGAACGAAGCGCTGCTGGAGCAGTGGCGCCGGTTGC
GCCCACGCCGCCCCCTGGACGCCATTGTCTGGGCGCTGAACCCGGAGCAGAGCGCGGATTCCGACTACCT
GGGGCGCTACCTTGGCCACTTGCAGGCGCTGACGCGGCGGCTGCGCTGGCGAGCGCCGCTGCACTTCTGG
GAGGTGCGCCGCAGTGACTGGATGCAGCCGGCCGCCGATGCCGAGGTGGGCTGCCTGCTGGCCGCCCATG
CCGGCCAGGCGCAGTTGGAGGATCAGCTCGACCGTCTGCTGCAGCCACTGCGCGAGCAAGGCCTGGCGCG
GATGCGCGGCGACAACCGCGAGGATTTCCTCCTGCGCCTGGCCCACGACCTGCAACACCACGGCATCGCC
CGCTGGCAGCGGGCCTGGGCGCAATTGCGGCGTGGCCCCGGGCTGCTGCCGCGCGGCCTGTGGTTCAGCC
TCGCGCTGCCTGCCGCCCCGGGCGGCGCTAAGCATGCGTGGCAGGCCCATCCCGCCTGGCGCGGCGTACT
GGATAACAAGGCCCTCGGCGGCCGGGTGCAGGGCTGGACCTGGCCGCGCATTGGCACCGCCCTGGCCCTC
GGCCTGGCCGTACTCTGGGGCCTGGGCCTGCTGCTTTCCTTCGTGGGCAACCGGGCGCAGGTCGCCGAGC
TCGAGACCGTGCTGGCCGCCCTCGACCAGCCGCGCGAAGGCGACGAACACGTGCTCGCGCTCAACGAACT
GGTCCACGAGCTCGACCGCCTCGACCATCGCGCCCAGCATGGCGTGCCCTGGTACCAGGGCTTCGGCCTG
AGCCAGAACGACGCCCTGCTTGCCGCCCTCTGGCCGCGCTACCAGGCGGCCAACAACCGTCTGCTGCGCG
ACCCGGCGGCGGCCAGGCTGGAAAGCGGGTTGCGCGAGTTGCTCGCCCTGCCGCCCGGCAGCCCCGAGCG
CGCCCTCCATGTCCAGGGCGCCCATGCCTCGCTCAAGGCCTACCTGATGATGGCCCGCCCGGAACGGGCC
GACGCGGCGTTCCTCGGCAAGACCCTCGCCGCCCTGGAGCCTGAGCGCGCCGGCATCGGCGACGGCGTCT
GGCAGGGCATTGCGCCCAACCTCTGGCGCTTCTACGCCGAGCAACTGGCGGCGCACCCCGAATGGCGCAT
CGAGGCCGACGCCGCGCTGATCGCCCAGGCCCGCCAGGTCCTGCTCGGCCAGCTCGGCCAGCGCAATGGC
GAAGCCAGCCTCTACGAGGCGGTGCTCGAGGCCACGGCCAGCCAGTATCCGCCCCTGGGCCTGCAGCAAC
TGGTCGGCGATACCGACGCGCAGTGGCTGTTCTCGACCGACGCCGAGGTGCCCGGGGTGTTCACCCGCCA
GGCCTGGGAGGGCCGGGTACGCAAGGCCATCGACGAGGCGGCTTCCGCGCGGCGGGAAGAAATCGACTGG
GTGCTGAGCGACGACCAGAGCCAGGTCGCCGCGGAGTTGAGCCCAGAGGCCCTGCGCGAACGGCTCACCG
CGCGCTATTTCCAGGACTACGGCAACGCCTGGCTGGGCGTGCTCAATAGCCTGCGCTGGCAGCCGGCCAA
CAGCCTCGCCGAGGTCATCGACCAGCTCACCCTGATGGCCGACGTGCGCCAGTCTCCGCTCATCGCCCTG
ATGAACACGCTGGCCTACCAGGGCCAGGCCGGCACCCGCCGGCAGGCCCTGGGCGATTCGCTGGTGCAGT
CCGCGCAGAAGCTCATCGGCCAGGACCAGGCCCCGGTCATCGACGTGCAGGCCCTGGCTCCGGAAGGCCC
GCTGGACGACAGCTTCGGCCCACTGCTCGCCCTGCTCGGCAAGGGCGATGCGCTGGCCGGCGAGGACCGC
CTGAGCCTGCAGGCCTTCCTCACCCGGGTCACCCGCGTGCGCCTGAAGCTCCAGCAGGTAAGCACCTCTC
CCGACCCCCAGGCGATGATCCAGGACCTGGCGCAGACCGTGTTCCAGGGCCGCAGCGTCGACCTCGCCGA
CACCCAGGCCTACGGCAGCCTGGTGGCCGCCAGCCTCGGCAGCGAGTGGAACGGTTTCGGCCAGGCGCTC
TTCGTCCAGCCGCTGGACCAGGCCTGGCGGCGCATCCTGCAGCCCTCCGCCGCTGGCCTCAACGCGCAAT
GGCAACGCGCGATCGTCGCCCCCTGGGACGCCGCCTTCGCCGGCCGCTACCCCTTTGCCGCCACCGCCAG
CGACGCCTCCCTGCCCATGCTCGGGCTGATGATCCGGGGCGACAGCGGCCGGATCGACCAGTTCCTCGCC
CGGCAGCTGGGTGGTGTCCTGCGCAAGGAAGGCCACCGCTGGGTGCCTGAGGCCGCCCAGAGCCAGGGGT
TGCGCTTCAACCCCGAGTTCCTCGCGGCGGTCAACCGGCTCAACGATCTCGCCGACGTGCTCTACACCGA
CGGCGGCATGGGTATCGGCTTCGAGCTGCAGGCCAAGCCGGTGCGCGATGTCGAGCAGACCACCTTCATC
CTCGACGGCAACCGCCTGACCTACTTCAACCAGCGGGAGCGCTGGCAGCGTTTCACCTGGCCCGGAACGG
GCGACCATCCTGGCGCGAACCTGCGCTGGACCAGCGTCAAGGCTGGCGAGCGGCTGTTCGGCGACTACCC
CGGCACCTGGGGGCTGATCCGCCTGCTGGAACAGGCCCGGGCCACCCCGCTGGACGATGGCCACAGCCGT
TACCGCCTGGTGCTCCAGGCCCCCGACGGCCTGGGCCTGACCTGGCACCTGCGCACCGAACTGGGGGCCG
GTCCGCTGGCGCTGCTGCAACTGCGCGGCTTCAAGCTGCCGGCGCGGATATTCCTCGAAGACGGCGGTAC
ACCGCTGTCGCTGATGACACACGGAGAACTGCCATGA
 Primer design