SecReT6
Protein ID: 512648101
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00770
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]21356..24967 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDR9VFY5
KEGG IDenr:H650_00770
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.10E-99, Aligned region: 205..480
ImcF-related_N [PF14331], Evalue: 8.10E-99, Aligned region: 761..855
IcmF-related [PF06761], Evalue: 1.20E-87, Aligned region: 528..835
DUF1215 [PF06744], Evalue: 6.80E-30, Aligned region: 944..1069
Protein Sequence: 1203 a.a.     [Download]
>gi|512648101|ref|YP_008106010.1| type VI secretion system protein ImpL [Enterobacter sp. R4-368]
MNMLLSLLTNRILWGFLGVTGLAAVIWMIGPLLSVVDSRPLESEQNRMITIAVMYLIWVHSHIVPRLYNA
WLNRKLMDNLKSEEAKDPVERKRLNNEDQVLNERFEEAAQVLKKAHFNQPGQRGQWAQRFSTQYLYQLPW
YVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQVQDA
SEWLKFLGLLQKYRRRQPINGVIVTVSIADLLTQSAEASREQALNLRQRLTELHEQLGIRFPVYVLVTKA
DLLKGFRAYFAGFDKAQRDQIWGFTFPWEKAKLADFDLQGSFIQEFALLQQRLDAALPDTLLRESDAQAR
AECFLFPQEFAALRPLLADYLNTIFARSNFETEFSPRGIYFASGTQEGLPFDRVMGELNRALSLPQGKSG
DNWDSVSKEEPVPGGKGQSFFIKHLLQNVIFQEAGIAGQNRWWELRSRAVIWSGYAALLALLIIISALWF
TSYGNNRDYLDEVQAKVPALDQQIKALRNRQQGDLFALLPLLNGLSALPESEKFDVNNPPITRRMGLYRG
NDVADASQTLYQKALQQMLLPEVAMRITTWLRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSWVMLN
LQRNLPQNVTKAQLSQLEWHLTQLLEPQIQSSPYAKDEALISREQALINQQPLSTRVYGRLKRLLERDEN
LKQVSLASLGGPQSELVFSRKSGKPVGEGLPGLYTPDGYWNSFNAQIAPVTASLHEDDVWVLGSTTQAED
KQQTDNAVRQLYARDFIAIWDNFLSDIQLNNSADLNQRINTARLLSGNNSPLRRLVINLSQQLKLSRDDV
ADGKEKAPESSNRGTQMLETLFSNHDGASATANAAASQTPEQRVTEHFAPIIELAQPLEKGGKTIVFDDF
LKQVDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQTMFSNMAVGASSDTQRRDMENVRKR
ISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGLMDVFFRDNLTNKVDTTQATWRFMPGIDG
KTLPGSEGVLVPFQQAQSIRDAFFANGSATPSFRTTVRTVRMDNTILNMTLDVDGQILRYSHGPQAVQIV
SWPGSGGTNQVRMQLGLANGTTATLVTNGAWALNRFFDKARVSPGSSSLSRQATFTVDGHQVTLEFAPNS
IRNPFQLPRFACP
 
Nucleotide Sequence: 3612 bp     [Download]
>gi|512647881|ref|NC_021500.1|:21356-24967 Enterobacter sp. R4-368, complete genome
ATGAATATGTTGCTTTCATTGCTGACCAACCGCATTTTGTGGGGTTTCCTTGGCGTAACGGGGCTGGCCG
CGGTTATCTGGATGATTGGCCCGCTGCTCTCCGTCGTGGATTCCCGCCCGCTTGAGTCTGAGCAAAACCG
CATGATCACCATTGCGGTGATGTACCTGATTTGGGTTCACAGCCACATTGTGCCGCGTCTTTACAACGCC
TGGCTCAACCGCAAGCTGATGGACAACCTGAAAAGCGAAGAGGCAAAAGATCCGGTTGAGCGCAAACGCC
TCAATAACGAAGATCAGGTGCTGAACGAGCGTTTCGAAGAAGCTGCGCAGGTACTGAAAAAAGCGCACTT
CAACCAGCCAGGTCAGCGCGGACAGTGGGCGCAGCGCTTCAGCACCCAGTATCTGTATCAACTGCCATGG
TATGTGATTATCGGTGCGCCGGGTTCCGGTAAAACCACTGCGCTGGTCAACTCCGGCCTGCAATTCCCGC
TGGCCGATCGCTTCGGTAAAACCGCGCTGCGCGGTATTGGCGGTACGCGTAACTGTGACTGGTGGTTTAC
CAACGAGGCTGTGCTGCTTGATACCGCCGGGCGTTATACCACGCAGGAGAGCGAGCAGGTTCAGGATGCG
AGCGAATGGTTGAAGTTTCTTGGCCTGCTGCAAAAGTATCGCCGCCGTCAGCCGATCAACGGTGTGATTG
TGACGGTAAGCATTGCCGATCTGCTCACCCAGTCAGCCGAGGCATCGCGCGAACAGGCGCTTAACCTGCG
CCAGCGTTTGACCGAGTTGCATGAACAACTGGGGATCCGTTTCCCGGTGTATGTGCTGGTGACCAAAGCG
GACTTGCTGAAAGGTTTTCGCGCGTACTTTGCCGGGTTTGATAAAGCGCAGCGCGATCAAATCTGGGGTT
TCACCTTCCCGTGGGAAAAAGCCAAACTGGCGGATTTCGACCTGCAGGGCAGTTTTATTCAGGAATTCGC
GCTGCTGCAACAGCGTCTGGACGCGGCCCTGCCGGATACGCTACTGCGTGAAAGCGATGCGCAAGCCCGC
GCGGAATGTTTCCTGTTCCCGCAGGAGTTCGCCGCGCTGCGTCCGCTGCTGGCAGATTACCTGAACACCA
TTTTTGCCCGCTCTAACTTTGAAACCGAGTTCTCCCCGCGCGGCATCTATTTTGCCAGCGGTACGCAGGA
AGGCCTGCCGTTTGACCGCGTGATGGGCGAACTGAACCGCGCGCTGTCGCTGCCGCAGGGTAAATCAGGC
GATAACTGGGATTCGGTCAGCAAAGAGGAACCGGTGCCGGGCGGGAAAGGGCAGAGCTTCTTTATCAAGC
ATCTGCTGCAAAACGTGATCTTCCAGGAAGCCGGTATCGCCGGGCAAAACCGCTGGTGGGAACTGCGCAG
CCGGGCGGTGATCTGGTCCGGTTATGCGGCGCTGCTGGCGCTGCTGATTATTATCAGCGCCTTGTGGTTT
ACCAGCTACGGCAACAACCGTGATTATCTGGATGAAGTGCAGGCCAAAGTACCGGCCCTTGACCAGCAGA
TCAAAGCGCTGCGTAACCGCCAGCAGGGCGATCTCTTTGCCTTGCTGCCGCTGCTTAATGGCCTCTCTGC
GCTGCCGGAAAGCGAGAAGTTTGACGTCAATAACCCACCGATCACCCGCCGTATGGGGCTCTATCGCGGT
AACGATGTGGCTGACGCCTCGCAAACCCTGTACCAGAAAGCGCTGCAACAGATGCTGCTGCCGGAAGTGG
CGATGCGCATCACCACCTGGCTGCGTAACGACAATGGCAGCGATGTGGAATACAGCTATGAAGCGCTGAA
AGCCTATCAGATGCTGTATCAGCCGAAGCATTACGACGGTAAGTTCCTGCACTCGTGGGTAATGCTCAAT
CTGCAACGTAACCTGCCGCAGAACGTTACCAAAGCGCAGTTAAGTCAGCTTGAGTGGCACCTGACGCAAC
TGCTGGAGCCGCAAATTCAGTCGTCGCCGTATGCCAAAGACGAGGCGCTGATTAGCCGCGAACAGGCATT
GATCAACCAGCAACCGCTCTCCACCCGCGTTTACGGGCGGCTGAAACGCCTGCTGGAGCGCGATGAAAAC
CTGAAGCAGGTTTCGCTGGCGTCGCTTGGCGGCCCGCAGAGTGAACTGGTCTTTTCCCGCAAAAGCGGTA
AGCCGGTCGGTGAAGGGTTGCCGGGGTTGTATACCCCGGATGGTTACTGGAACAGTTTCAATGCGCAAAT
CGCGCCGGTCACCGCCTCGCTGCATGAAGATGATGTCTGGGTGCTTGGCTCCACCACGCAAGCGGAAGAC
AAACAGCAAACCGATAACGCGGTGCGCCAGTTGTATGCACGGGATTTTATCGCCATCTGGGATAACTTCT
TAAGTGACATTCAGCTTAATAACAGCGCGGATCTGAACCAGCGCATCAATACCGCGCGTCTGCTTTCCGG
AAACAACTCACCGCTGCGCCGGCTGGTTATCAATCTCAGCCAGCAGTTGAAACTCAGCCGTGATGACGTG
GCGGATGGTAAAGAGAAAGCGCCGGAGAGCAGCAACCGTGGTACGCAGATGCTCGAAACGCTGTTCAGCA
ACCATGACGGCGCGTCAGCCACGGCAAACGCCGCCGCCAGCCAGACGCCGGAACAGCGTGTCACCGAACA
TTTCGCGCCGATCATCGAACTGGCGCAGCCGCTGGAAAAGGGCGGCAAGACCATTGTGTTTGATGATTTT
CTCAAACAGGTTGATGAGCTTTATCGTTACCTGACCGCCGTGCAGGATGCCGCCAACAGTGGAATGCCAC
CGCCGGGCGGCGAAGCAATCAGCCGTTTGCAGGCCAGTGCCGGGCGTTTACCTGGCGGGCTGCAAACCAT
GTTCAGCAACATGGCGGTTGGCGCGAGCAGTGATACCCAGCGCCGGGATATGGAAAACGTGCGCAAGCGC
ATCAGCGTGGAAGTGGGCAGCTTTTGCCGCCAGGCGATTGCCGGACGCTACCCGTTAGTGCGTTCCGCCA
GCAGCGAAGTTACCCCCGACGATCTGGCACGCATGTTTGCCCCTGGTACTGGCCTGATGGATGTCTTTTT
TCGCGACAACCTGACCAACAAAGTCGATACCACTCAGGCGACATGGCGTTTTATGCCGGGCATCGATGGC
AAAACCCTGCCGGGCAGTGAAGGGGTGCTGGTGCCGTTTCAGCAAGCGCAATCGATTCGTGACGCGTTCT
TTGCCAACGGCAGCGCAACACCGTCGTTTCGCACCACGGTGCGTACGGTGCGCATGGATAACACCATCCT
GAATATGACGCTGGATGTAGACGGACAAATCCTTCGCTACAGCCACGGCCCACAGGCGGTGCAAATCGTT
AGCTGGCCGGGTTCCGGCGGCACCAACCAGGTGCGGATGCAGTTAGGGCTGGCCAACGGTACAACCGCTA
CGCTTGTGACCAACGGCGCCTGGGCGCTGAACCGCTTTTTCGATAAAGCGCGCGTCAGCCCCGGCAGCAG
CAGCCTGAGCCGCCAGGCGACATTCACGGTTGACGGACATCAGGTGACGCTGGAATTCGCGCCGAACAGC
ATCCGCAACCCGTTCCAGCTTCCACGTTTCGCATGTCCTTGA
 Primer design