SecReT6
Protein ID: 512650055
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11200
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2191227..2194607 [-]
Producttype VI secretion protein VasK
NoteTssM
UniProt IDR9VN87
KEGG IDenr:H650_11200
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.90E-76, Aligned region: 416..728
DUF1215 [PF06744], Evalue: 4.30E-34, Aligned region: 849..970
Protein Sequence: 1126 a.a.     [Download]
>gi|512650055|ref|YP_008108055.1| type VI secretion protein VasK [Enterobacter sp. R4-368]
MKVKTLIGSIVLTLIFFIAIFVYLFMAWPEKMSSWTGIGPLDDTQLLIWSLVSILIIGLIGWVTERLFER
AGKTGVRAAFEENKRESTGHQTSLVLHDQGEKGFFDSVELTDHLRLRYGRRWKSKVRLLLVQGTDDHIEK
VVPGLKRDHWQENDGTVLIHAGLAKAEQEPEFVDALNKVRPQQPIDGIVHVMDCAQLPDAAALDSLVRSR
QKGDVLIGWQAPVWLWFIREEAWSQEGEGVPATGTFFGPGAAPEAAIESLTTLSSRLRRVGIQVLLRNTR
HDWLLQLSVQLRGRLKQQLTPLLTSLMTGPAPYRLRGVMFSPVLPATSTLPHARLSHPAWQALEEDCLHV
QARKIGFHWRRVLPLMLLAVVLLWGAGTLLSLTVNRAQIYQAQETARVAADTKQPLTERLRNQLILQQAI
ARLQDRQAHGAPWYTRFGLNQDRETLNSLWPLYARNNQALMRDALADELRRQLTAFVRLPPASDARTTAA
QKTYNLLKGYLMLARPDKADAPWFAANMLKTWPTRTGVSDSVWQTLAPKLLGFYAQNLPAHPEWKIKPDA
DLVGTVRQILLKQIGQRNAESGLYQEMLQRIARNWPDLTLADMTGDTDASTLFSTAEVVPGMFTRQAWEE
QVEGAIDEVVKTRRAEIDWVLTDKTHQAGSDISPEALEQRLTERYFTDFGNAWLNMANSIQWHEAESLSE
AIAQLNLLADVRQSPLVALMNTLAWQGQTGAEGERLADSLVDSAKKLVASKKNAQQFIEQAQGPKGPLDG
VFEPLNGLMAGKDGTGANGNLSFQSWLARVTQVRLKLQQVTSAPDPQAMAQMLAQTVFQGKAIDLTDTRD
YGGLVAASLGQEWNGFAQALFVQPLDLAWRQVLAPAADSLNARWQSTIVSQWNTAFAGRYPFKATGSDAS
LPLLAQFVRGDSGYIAAFLKTNLGGILHQEGSHWVVDPSASQGMAVNPAFLTAINQLADISDIIFAQGDA
GVHFELMARPSRDVARMQLTLDGQNLDYFNQMESWQSFTWPGNTWYPGVDLSWRSVNTEMRLFEHYQGNW
GFIRLLDKALMTPLDSSRTQLVWRTPDGSPLKFILRSELGDGPLALLKLQGFHLPQSIFAVSADTVNNPL
AATEGE
 
Nucleotide Sequence: 3381 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2194607-2191227 Enterobacter sp. R4-368, complete genome
GTGAAAGTAAAAACACTTATCGGGAGCATCGTACTCACCCTTATTTTTTTCATCGCCATTTTTGTGTACC
TGTTTATGGCTTGGCCAGAAAAAATGTCGAGCTGGACTGGCATCGGCCCGCTTGATGATACCCAATTGCT
TATATGGAGTCTGGTTTCAATTCTCATCATTGGCCTCATCGGTTGGGTGACCGAACGACTGTTTGAGCGC
GCAGGAAAAACGGGGGTCAGGGCGGCTTTCGAGGAAAATAAAAGAGAGTCTACCGGACATCAGACTTCAC
TCGTTCTCCATGATCAAGGTGAGAAGGGCTTTTTCGATAGTGTAGAACTCACCGATCACCTCCGTCTGCG
CTACGGCCGCCGCTGGAAATCTAAAGTCCGCCTGCTGCTGGTTCAGGGTACCGATGACCATATTGAAAAA
GTGGTTCCGGGGCTCAAGCGTGACCACTGGCAGGAAAATGACGGCACTGTTCTGATCCATGCCGGGCTGG
CAAAAGCTGAGCAGGAGCCAGAATTTGTTGACGCGCTGAATAAGGTGCGCCCTCAGCAGCCGATAGACGG
CATTGTGCATGTAATGGACTGCGCGCAACTTCCGGATGCCGCTGCGCTGGATTCGCTCGTTCGCAGCCGT
CAGAAAGGTGATGTGTTGATTGGCTGGCAGGCTCCGGTCTGGCTGTGGTTTATCCGTGAGGAGGCGTGGA
GTCAGGAAGGCGAGGGTGTGCCGGCGACCGGCACATTCTTCGGGCCGGGGGCTGCACCAGAAGCCGCTAT
TGAGTCACTGACGACACTTTCTTCTCGTTTGCGCCGTGTGGGTATACAGGTGTTGCTGCGTAATACCCGC
CACGACTGGCTTCTGCAGTTATCCGTTCAGCTGCGCGGACGTCTTAAGCAACAGTTAACCCCCTTGCTGA
CCAGCCTGATGACCGGCCCGGCACCTTACCGCCTGCGCGGGGTCATGTTCAGCCCTGTGCTGCCAGCAAC
CTCCACGTTGCCGCACGCGCGTCTGAGCCACCCGGCCTGGCAGGCGCTGGAAGAGGATTGTCTGCATGTT
CAGGCCCGCAAAATCGGTTTCCACTGGCGGCGTGTTCTCCCTCTGATGTTGCTGGCAGTGGTTCTGCTGT
GGGGGGCAGGAACACTGCTTTCCCTGACCGTGAACCGTGCCCAGATTTATCAGGCCCAGGAAACCGCGCG
CGTTGCCGCCGATACAAAGCAACCGTTGACGGAACGCCTGCGTAATCAGCTCATTCTGCAGCAGGCCATT
GCCCGTTTGCAGGACAGGCAAGCCCACGGCGCGCCCTGGTATACCCGCTTTGGTCTGAATCAGGACCGTG
AAACACTGAATTCCCTCTGGCCACTGTATGCCCGCAACAACCAGGCGCTGATGCGCGATGCGCTGGCTGA
TGAGCTCCGCCGTCAACTGACCGCGTTTGTGCGACTCCCCCCAGCCAGTGATGCACGTACAACCGCTGCC
CAAAAGACCTATAACCTTCTCAAGGGCTATCTGATGCTGGCACGTCCGGATAAAGCGGATGCGCCGTGGT
TTGCTGCAAACATGCTGAAAACCTGGCCGACACGCACTGGCGTTAGCGACAGCGTCTGGCAGACGCTGGC
CCCCAAACTGCTCGGGTTCTATGCCCAGAACCTGCCCGCGCACCCGGAGTGGAAAATTAAGCCGGATGCA
GACCTGGTTGGCACCGTACGTCAGATTCTGCTCAAACAAATTGGGCAGCGTAATGCGGAGTCTGGTCTGT
ATCAGGAGATGCTGCAGCGCATCGCCCGCAACTGGCCGGACTTAACACTGGCAGATATGACAGGTGATAC
CGACGCATCGACCCTATTTTCTACCGCCGAAGTTGTGCCGGGCATGTTTACCCGCCAGGCATGGGAAGAG
CAGGTCGAGGGTGCTATTGATGAAGTGGTGAAAACCCGCCGCGCGGAAATCGACTGGGTGCTGACCGATA
AGACTCATCAGGCCGGGAGCGATATCTCGCCGGAAGCGCTGGAGCAGCGCCTGACTGAGCGCTACTTTAC
CGATTTCGGTAATGCCTGGCTGAACATGGCCAACAGCATTCAGTGGCATGAGGCCGAATCGCTGTCCGAA
GCGATTGCCCAGCTTAACCTGCTGGCGGATGTGCGTCAGTCACCGCTGGTGGCGCTGATGAACACGCTGG
CCTGGCAGGGACAGACCGGTGCCGAAGGCGAGCGGCTTGCCGATTCACTGGTTGACTCGGCGAAAAAGCT
GGTCGCGAGTAAAAAGAATGCGCAACAGTTTATCGAACAGGCTCAGGGGCCCAAAGGGCCGCTGGATGGC
GTGTTTGAACCACTGAACGGCCTGATGGCAGGGAAAGACGGCACGGGCGCTAACGGTAATCTCAGTTTCC
AGTCGTGGCTGGCGCGAGTGACGCAGGTGCGCCTCAAACTGCAGCAGGTTACCAGCGCACCTGATCCGCA
AGCGATGGCGCAGATGCTGGCGCAGACGGTCTTTCAGGGCAAGGCCATCGATCTGACGGATACCCGTGAT
TACGGCGGTCTGGTGGCGGCAAGCCTTGGGCAGGAGTGGAACGGTTTTGCTCAGGCGCTGTTTGTGCAGC
CGCTGGATTTGGCCTGGCGCCAGGTGCTGGCCCCGGCGGCAGACAGTCTGAATGCCCGCTGGCAGAGCAC
GATTGTGTCGCAGTGGAACACGGCGTTTGCCGGACGTTACCCGTTTAAAGCCACAGGAAGCGATGCCTCA
CTTCCCTTGCTGGCGCAGTTCGTGCGTGGTGATTCCGGGTATATTGCGGCATTCCTCAAAACCAACCTCG
GCGGGATCCTGCATCAGGAAGGCAGCCACTGGGTGGTCGATCCTTCTGCAAGCCAGGGGATGGCCGTCAA
CCCCGCCTTCCTGACGGCTATCAACCAACTGGCAGATATTTCCGACATTATTTTCGCGCAGGGAGATGCG
GGTGTGCATTTTGAACTGATGGCCCGCCCTTCACGTGATGTTGCACGGATGCAATTGACGCTGGACGGTC
AGAATCTTGATTACTTCAACCAGATGGAAAGCTGGCAGAGCTTCACCTGGCCGGGAAATACCTGGTATCC
GGGTGTGGATCTGAGCTGGAGAAGCGTGAACACGGAAATGCGCCTCTTTGAGCACTATCAGGGAAACTGG
GGCTTTATCCGTTTGCTCGATAAAGCGCTGATGACGCCGCTCGACAGCAGTCGTACGCAACTGGTGTGGC
GCACGCCGGATGGCAGCCCGCTTAAATTTATCCTGCGCAGCGAACTGGGGGATGGCCCCCTGGCACTACT
GAAGCTGCAGGGTTTCCACTTGCCGCAATCTATCTTCGCGGTAAGTGCGGATACCGTGAATAACCCGCTG
GCAGCCACGGAGGGAGAATAG
 Primer design