SecReT6
Protein ID: 514407706
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00400
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]92525..96055 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDR9Z9H7
KEGG IDprp:M062_00400
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.40E-98, Aligned region: 86..127
ImcF-related_N [PF14331], Evalue: 3.40E-98, Aligned region: 192..455
IcmF-related [PF06761], Evalue: 2.60E-92, Aligned region: 504..799
DUF1215 [PF06744], Evalue: 2.10E-40, Aligned region: 71..105
DUF1215 [PF06744], Evalue: 2.10E-40, Aligned region: 694..726
DUF1215 [PF06744], Evalue: 2.10E-40, Aligned region: 914..1035
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 130..287
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 598..683
AAA_16 [PF13191], Evalue: 0.0053, Aligned region: 127..255
AAA_16 [PF13191], Evalue: 0.0053, Aligned region: 594..645
AAA_16 [PF13191], Evalue: 0.0053, Aligned region: 777..849
Protein Sequence: 1176 a.a.     [Download]
>gi|514407706|ref|YP_008130546.1| type VI secretion protein IcmF [Pseudomonas aeruginosa RP73]
MKGFLNFFARWVVPVLGLLALSLIIWFLGPLLRLGNYEPLASATSRWVLIVLLFLVWIGFRVLRIVQARR
NAAKVMQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKT
TALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKT
QRKRRPIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDS
LNREERAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAAL
RECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIER
LFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGI
ESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQL
RSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSAR
LDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTY
RGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVT
QAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGAREQP
RQVDSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASR
VALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDF
GHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPTVR
FELKPVTMDAAISQFILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAW
FRLLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c96055-92525 Pseudomonas aeruginosa RP73, complete genome
ATGAAAGGCTTCCTCAACTTCTTCGCGCGCTGGGTGGTGCCGGTGCTCGGCCTGCTCGCCCTGAGCCTGA
TCATCTGGTTCCTCGGCCCGCTGCTGCGCCTGGGCAACTACGAACCGTTGGCCTCGGCGACCAGCCGCTG
GGTGCTGATCGTCCTGCTGTTCCTGGTCTGGATCGGCTTCCGCGTGCTGCGCATCGTGCAGGCCCGGCGC
AACGCGGCGAAGGTCATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCG
AAGAGCTGGCGACCCTCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGTTGGGCGG
CAGCGAGCGGCGCAACCTGTACGAGTTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACC
ACCGCGCTGATGAATTCCGGCCTCGACTTCCCGCTCGCCGCGCAGATGGGCGCCGGGGCGATCCGCGGGG
TCGGCGGCACGCGCAACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTA
TACCACCCAGGACAGCCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACC
CAGCGCAAGCGCCGCCCCATCGATGGCGCGTTCATCGCCATCAGCCTTTCCGACCTGCTGCTGGGCAGCG
ACGCCGAGCGCGCCGCCCATGCCCAGGCGATCCGCGCACGCATCCAGGAGCTGTACCAGCAGCTCGGGGT
GCGCTTCCCGATCTACGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAGC
CTGAACCGCGAGGAACGCGCGCAGGTCTGGGGGATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAG
GCCCGCTGGCGGTGTTCGACAGCGAATTCGCCCTGCTCGAACAGCGTCTCACCGCGCGCCTGGTGGAACG
CCTGCAGCAGGAGCGCGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAATTCGCCGCCCTG
CGCGAATGCCTCGGCGAGTTCCTCAACGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGC
GCGGCCTGTACTTCACCAGCGGAACCCAGGAAGGCAGTCCGATCGACCGCCTGATCGGCAGCATGGCGCA
GTCGATGAACCTCGACCGCCAGCACCTGGCGCGGCAGACCGGAACCGGGCGCAGCTACTTCATCGAGCGG
CTGTTCCGCGAAGTGGCGTTCGGCGAACGCGGCCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCA
AGTGGCTGACCATCGGCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGC
CAGCTACCGCGCCAACCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATC
GAGTCGCTGAGCCCGGCCCAGCGCGACGTCCTGGCCGTACTGCCACAGCTCAACGCGGTGCAGAATCTCG
CCGGCGACGCGCCGAGCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGC
CAGCGTCTACCGCAAGCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGTTG
CGCTCCGGCGGCAGCAGCGATTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGCAGCCCGGACC
ATTACGACGCCGACTTCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTC
GCCGGAACAGCGCCAGGCGCTGCACGCGCACCTCGACGCGTTGCTCGAACGACGGCCGCCGTCGGCGCGC
CTGGACCAGGACCTGGTCGAGGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCGCAGCGGGTCTACG
ACCGGGTCAAGCGGCAGAGGCTGCCCAAGGACGTGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGA
CGCGCCGCTGGTGTTCGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTAC
CGCGGCTATCGCGAGGTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGG
TGCTCGGGCGCGACCTGAACGATGCCGGCGACGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTATTT
CCAGGACTACCTGCGGCAGTGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAATGTCACC
CAGGCCGCCGACGTGCTGCGCATTCTCTCCGGACCGACGTCGCCGTTCCGCAAGCTGCTCGAGGCGGTGG
CCCGCGAGACCGACCTGCAGAAGGGCGACCGGCTGGTCGCCGCGCAAGTGAAGAAGGCCGCCGACGGCAC
CGTGGACAAGCTCAAGCAGCGCCTCGGCTCGCTGGTCGGCCAGGAGGAAGAGGGCGCCCGCGAACAGCCG
CGGCAGGTCGACAGCGACCCGATCAGCGCCCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCGAGG
GTGGCAACGAGCCGGCGCCGATCGACAGCCTGCTGGAGGACATGAACGCGCTCTACGTACAGGTCAGCGC
CATGGCCGGAGCCAGCGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCGCGC
GTGGCCCTCAGCGCCGAGCGCCAGCCGCCGGTGGTCCAGGGCCTGGTGAAGAACGTGGTCAACTCCACCA
CCAGCAGCATGATGGGCAGCGTGCGCAACCAGCTCAACGCGGCCTGGATCAGCGACGTGGTCAGCGTCTA
CCGGCAATCCCTGGCCGGGCGCTACCCGATCGCCGCCGGCAGTTCGCGCGACGCCACCCTGGAAGACTTC
GGCCACTTCTTCGGTGCCGGCGGGGTGATGGACAGCTACTTCCGCCAGTACCTGCAACCCTACGTCGACA
CCTCCGCCAGCACCTGGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCTGCA
CACTTTCCAGCGCGCAGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAACCGACGGTGCGC
TTCGAGCTCAAGCCGGTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGCAGC
TGACCTACGACCACGGCCCCAGCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGTGGT
CCGCCTGACGGTGACGCCGCCGCCCAGCAGCGGCCGTTCCGGCCTGACCCTGGAAGGCCCCTGGGCCTGG
TTCCGCCTGCTCGACCAGTCGGACCTGGAACGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGCGCA
TCGACGGCTCCAGCATCGCCTGCGAGCTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGTCGT
GTCCGGCTTCAGCCTCCCGGAGCGCCTTTGA
 Primer design